Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse SMAD7 Monoclonal Antibody | anti-SMAD7 antibody

SMAD7 (SMAD Family Member 7, CRCS3, FLJ16482, MADH7, MADH8) (MaxLight 490)

Gene Names
SMAD7; CRCS3; MADH7; MADH8
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
SMAD7; Monoclonal Antibody; SMAD7 (SMAD Family Member 7; CRCS3; FLJ16482; MADH7; MADH8) (MaxLight 490); SMAD Family Member 7; MADH8; anti-SMAD7 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C12
Specificity
Recognizes SMAD7.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-SMAD7 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SMAD7 (NP_005895, 302aa-400aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFV
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SMAD7 antibody
Mouse monoclonal antibody raised against a full length recombinant SMAD7.
Product Categories/Family for anti-SMAD7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
mothers against decapentaplegic homolog 7 isoform 1
NCBI Official Synonym Full Names
SMAD family member 7
NCBI Official Symbol
SMAD7
NCBI Official Synonym Symbols
CRCS3; MADH7; MADH8
NCBI Protein Information
mothers against decapentaplegic homolog 7
UniProt Protein Name
Mothers against decapentaplegic homolog 7
UniProt Gene Name
SMAD7
UniProt Synonym Gene Names
MADH7; MADH8; MAD homolog 7; Mothers against DPP homolog 7; MAD homolog 8; Mothers against DPP homolog 8; SMAD 7; Smad7; hSMAD7
UniProt Entry Name
SMAD7_HUMAN

NCBI Description

The protein encoded by this gene is a nuclear protein that binds the E3 ubiquitin ligase SMURF2. Upon binding, this complex translocates to the cytoplasm, where it interacts with TGF-beta receptor type-1 (TGFBR1), leading to the degradation of both the encoded protein and TGFBR1. Expression of this gene is induced by TGFBR1. Variations in this gene are a cause of susceptibility to colorectal cancer type 3 (CRCS3). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

SMAD7: Antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit TGF-beta (Transforming growth factor) and activin signaling by associating with their receptors thus preventing SMAD2 access. Functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex. Also acts by recruiting the PPP1R15A- PP1 complex to TGFBR1, which promotes its dephosphorylation. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator. Genetic variations in SMAD7 influence susceptibility to colorectal cancer type 3 (CRCS3). Colorectal cancer consists of tumors or cancer of either the colon or rectum or both. Cancers of the large intestine are the second most common form of cancer found in males and females. Symptoms include rectal bleeding, occult blood in stools, bowel obstruction and weight loss. Treatment is based largely on the extent of cancer penetration into the intestinal wall. Surgical cures are possible if the malignancy is confined to the intestine. Risk can be reduced when following a diet which is low in fat and high in fiber. Belongs to the dwarfin/SMAD family.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 18q21.1

Cellular Component: nucleoplasm; transcription factor complex; protein complex; cell-cell adherens junction; cytoplasm; plasma membrane; catenin complex; cytosol; nucleus

Molecular Function: collagen binding; protein binding; ubiquitin protein ligase binding; metal ion binding; beta-catenin binding; activin binding; transforming growth factor beta receptor, inhibitory cytoplasmic mediator activity; transcription factor activity

Biological Process: transcription initiation from RNA polymerase II promoter; transcription, DNA-dependent; protein stabilization; negative regulation of transcription factor activity; negative regulation of peptidyl-serine phosphorylation; negative regulation of transcription from RNA polymerase II promoter; regulation of activin receptor signaling pathway; negative regulation of BMP signaling pathway; BMP signaling pathway; regulation of transforming growth factor beta receptor signaling pathway; ureteric bud development; positive regulation of protein ubiquitination; transforming growth factor beta receptor signaling pathway; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; negative regulation of ubiquitin-protein ligase activity; positive regulation of cell-cell adhesion; ventricular cardiac muscle morphogenesis; artery morphogenesis; positive regulation of transcription from RNA polymerase II promoter; gene expression; negative regulation of protein ubiquitination; negative regulation of transforming growth factor beta receptor signaling pathway; negative regulation of cell migration

Disease: Colorectal Cancer, Susceptibility To, 3

Research Articles on SMAD7

Similar Products

Product Notes

The SMAD7 smad7 (Catalog #AAA6208613) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SMAD7 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMAD7 smad7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMAD7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.