Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human NFE2L2 Monoclonal Antibody | anti-NFE2L2 antibody

NFE2L2 (Nuclear Factor (erythroid-derived 2)-like 2, NF-E2-related Factor 2, OTTHUMP00000164988, NRF2) (MaxLight 490)

Gene Names
NFE2L2; NRF2; HEBP1; Nrf-2; IMDDHH
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
NFE2L2; Monoclonal Antibody; NFE2L2 (Nuclear Factor (erythroid-derived 2)-like 2; NF-E2-related Factor 2; OTTHUMP00000164988; NRF2) (MaxLight 490); anti-NFE2L2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1B8
Specificity
Recognizes human NFE2L2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
605
Applicable Applications for anti-NFE2L2 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa71-170 from human NFE2L2 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NFE2L2 antibody
NFE2 (MIM 601490), NFE2L1 (MIM 163260), and NFE2L2 comprise a family of human genes encoding basic leucine zipper (bZIP) transcription factors. They share highly conserved regions that are distinct from other bZIP families, such as JUN (MIM 165160) and FOS (MIM 164810), although remaining regions have diverged considerably from each other (Chan et al., 1995 [PubMed 7868116]).
Product Categories/Family for anti-NFE2L2 antibody
References
1. Examining the endogenous antioxidant response through immunofluorescent analysis of Nrf2 in tissue. Lindl KA, Jordan-Sciutto KL. Methods Mol Biol. 2008; 477:229-43.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Nuclear factor (erythroid-derived 2)-like 2
NCBI Official Synonym Full Names
nuclear factor, erythroid 2 like 2
NCBI Official Symbol
NFE2L2
NCBI Official Synonym Symbols
NRF2; HEBP1; Nrf-2; IMDDHH
NCBI Protein Information
nuclear factor erythroid 2-related factor 2

NCBI Description

This gene encodes a transcription factor which is a member of a small family of basic leucine zipper (bZIP) proteins. The encoded transcription factor regulates genes which contain antioxidant response elements (ARE) in their promoters; many of these genes encode proteins involved in response to injury and inflammation which includes the production of free radicals. Multiple transcript variants encoding different isoforms have been characterized for this gene. [provided by RefSeq, Sep 2015]

Research Articles on NFE2L2

Similar Products

Product Notes

The NFE2L2 (Catalog #AAA6204901) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NFE2L2 (Nuclear Factor (erythroid-derived 2)-like 2, NF-E2-related Factor 2, OTTHUMP00000164988, NRF2) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFE2L2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NFE2L2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NFE2L2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.