Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human YBX1 Monoclonal Antibody | anti-YBX1 antibody

YBX1 (NSEP1, YB1, Nuclease-sensitive Element-binding Protein 1, CCAAT-binding Transcription Factor I Subunit A, DNA-binding Protein B, Enhancer Factor I Subunit A, Y-box Transcription Factor, Y-box-binding Protein 1, MGC104858, MGC110976, MGC117250) (MaxL

Gene Names
YBX1; YB1; BP-8; CSDB; DBPB; YB-1; CBF-A; CSDA2; EFI-A; NSEP1; NSEP-1; MDR-NF1
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
YBX1; Monoclonal Antibody; YBX1 (NSEP1; YB1; Nuclease-sensitive Element-binding Protein 1; CCAAT-binding Transcription Factor I Subunit A; DNA-binding Protein B; Enhancer Factor I Subunit A; Y-box Transcription Factor; Y-box-binding Protein 1; MGC104858; MGC110976; MGC117250) (MaxL; anti-YBX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F12
Specificity
Recognizes human NSEP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-YBX1 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 20ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa51-140 from human NSEP1 (NP_004550) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-YBX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38.3 kDa (347aa) confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
NCBI Official Full Name
nuclease-sensitive element-binding protein 1
NCBI Official Synonym Full Names
Y-box binding protein 1
NCBI Official Symbol
YBX1
NCBI Official Synonym Symbols
YB1; BP-8; CSDB; DBPB; YB-1; CBF-A; CSDA2; EFI-A; NSEP1; NSEP-1; MDR-NF1
NCBI Protein Information
nuclease-sensitive element-binding protein 1
UniProt Protein Name
Nuclease-sensitive element-binding protein 1
UniProt Gene Name
YBX1
UniProt Synonym Gene Names
NSEP1; YB1; CBF-A; DBPB; EFI-A; YB-1
UniProt Entry Name
YBOX1_HUMAN

NCBI Description

This gene encodes a highly conserved cold shock domain protein that has broad nucleic acid binding properties. The encoded protein functions as both a DNA and RNA binding protein and has been implicated in numerous cellular processes including regulation of transcription and translation, pre-mRNA splicing, DNA reparation and mRNA packaging. This protein is also a component of messenger ribonucleoprotein (mRNP) complexes and may have a role in microRNA processing. This protein can be secreted through non-classical pathways and functions as an extracellular mitogen. Aberrant expression of the gene is associated with cancer proliferation in numerous tissues. This gene may be a prognostic marker for poor outcome and drug resistance in certain cancers. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on multiple chromosomes. [provided by RefSeq, Sep 2015]

Uniprot Description

YB-1: a nuclear protein that binds to splice sites in pre-mRNA and regulates splice site selection. Binds and stabilizes cytoplasmic mRNA. Contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors CCAAT-containing Y-box of HLA class II genes. Component of cytoplasmic messenger ribonucleoprotein particles (mRNPs). Interacts with AKT1, SFRS9, THOC4, MSH2, XRCC5, WRN and NCL. Can bind to DNA as a homomeric form, (EFI-A)n or as a heteromeric form in association with EFI-B. Homodimer in the presence of ATP. Involved in cisplatin resistance. Seems to be a negative regulatory factor. May play a role in both transcriptional and translational regulation of spermatogenesis. Found at very low levels at day 10 and levels increase at day 15 and persist throughout adulthood.

Protein type: Transcription factor; RNA-binding; RNA splicing; RNA processing

Chromosomal Location of Human Ortholog: 1p34

Cellular Component: nucleoplasm; nuclear membrane; intracellular membrane-bound organelle; stress granule; cytoplasm; nucleus; ribonucleoprotein complex; U12-dependent spliceosome

Molecular Function: protein binding; DNA binding; RNA binding; double-stranded DNA binding; transcription factor activity; single-stranded DNA binding

Biological Process: transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; negative regulation of striated muscle cell differentiation; regulation of transcription, DNA-dependent; in utero embryonic development; positive regulation of cell division; RNA splicing; positive regulation of transcription from RNA polymerase II promoter; gene expression; negative regulation of transcription from RNA polymerase II promoter

Research Articles on YBX1

Similar Products

Product Notes

The YBX1 ybx1 (Catalog #AAA6204128) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The YBX1 (NSEP1, YB1, Nuclease-sensitive Element-binding Protein 1, CCAAT-binding Transcription Factor I Subunit A, DNA-binding Protein B, Enhancer Factor I Subunit A, Y-box Transcription Factor, Y-box-binding Protein 1, MGC104858, MGC110976, MGC117250) (MaxL reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's YBX1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 20ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the YBX1 ybx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "YBX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.