Mouse anti-Human WWP1 Monoclonal Antibody | anti-WWP1 antibody

WWP1 (WW Domain-containing Protein 1, Atrophin-1-interacting Protein 5, AIP5, NEDD4-like E3 Ubiquitin-protein Ligase WWP1, TGIF-interacting Ubiquitin Ligase 1, Tiul1, hSDRP1) (MaxLight 490)

Cat. Num. AAA6204117

• Gene Names: WWP1; AIP5; Tiul1; hSDRP1
• Reactivity: Human
• Applications: Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: WWP1; Monoclonal Antibody; WWP1 (WW Domain-containing Protein 1; Atrophin-1-interacting Protein 5; AIP5; NEDD4-like E3 Ubiquitin-protein Ligase WWP1; TGIF-interacting Ubiquitin Ligase 1; Tiul1; hSDRP1) (MaxLight 490); WW Domain Containing E3 Ubiquitin Protein Ligase 1; EC=6.3.2.-; anti-WWP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A7
• Specificity: Recognizes human WWP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

• Applicable Applications for anti-WWP1 antibody: FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa152-261 from human WWP1 (NP_008944) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT
• Conjugate: MaxLight490
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Product Categories/Family for anti-WWP1 antibody

Antibodies; Ubiquitin Ligases

NCBI and Uniprot Product Information

• NCBI GI #: 13654239
• NCBI GeneID: 11059
• NCBI Accession #: NP_008944
• NCBI GenBank Nucleotide #: NM_007013
• UniProt Accession #: Q9H0M0
• Molecular Weight: 105kDa
• NCBI Official Full Name: NEDD4-like E3 ubiquitin-protein ligase WWP1
• NCBI Official Synonym Full Names: WW domain containing E3 ubiquitin protein ligase 1
• NCBI Official Symbol: WWP1
• NCBI Official Synonym Symbols: AIP5; Tiul1; hSDRP1
• NCBI Protein Information: NEDD4-like E3 ubiquitin-protein ligase WWP1
• UniProt Protein Name: NEDD4-like E3 ubiquitin-protein ligase WWP1
• Protein Family: NEDD4-like E3 ubiquitin-protein ligase
• UniProt Gene Name: WWP1
• UniProt Synonym Gene Names: AIP5; Tiul1

NCBI Description

WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. The encoded protein belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. Alternative splicing of this gene generates at least 6 transcript variants; however, the full length nature of these transcripts has not been defined. [provided by RefSeq, Jul 2008]

Uniprot Description

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Ubiquitinates ERBB4 isoforms JM-A CYT-1 and JM-B CYT-1, KLF2, KLF5 and TP63 and promotes their proteasomal degradation. Ubiquitinates RNF11 without targeting it for degradation. Ubiquitinates and promotes degradation of TGFBR1; the ubiquitination is enhanced by SMAD7. Ubiquitinates SMAD6 and SMAD7. Ubiquitinates and promotes degradation of SMAD2 in response to TGF-beta signaling, which requires interaction with TGIF.