Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SLC6A16 Monoclonal Antibody | anti-SLC6A16 antibody

SLC6A16 (NTT5, Orphan Sodium-and Chloride-dependent Neurotransmitter Transporter NTT5, Solute Carrier Family 6 Member 16) (MaxLight 490)

Gene Names
SLC6A16; NT5; NTT5
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC6A16; Monoclonal Antibody; SLC6A16 (NTT5; Orphan Sodium-and Chloride-dependent Neurotransmitter Transporter NTT5; Solute Carrier Family 6 Member 16) (MaxLight 490); anti-SLC6A16 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E5
Specificity
Recognizes human SLC6A16.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
2904
Applicable Applications for anti-SLC6A16 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa406-493 from human SLC6A16 (NP_054756) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RCCERNAEILLKLINLGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKSMVLREVTECNIETQFLKASEGPKFAFLSFVEAMSFLP*
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SLC6A16 antibody
SLC6A16 shows structural characteristics of an Na(+)- and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.
Product Categories/Family for anti-SLC6A16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens solute carrier family 6 member 16 (SLC6A16), mRNA
NCBI Official Synonym Full Names
solute carrier family 6 member 16
NCBI Official Symbol
SLC6A16
NCBI Official Synonym Symbols
NT5; NTT5
NCBI Protein Information
orphan sodium- and chloride-dependent neurotransmitter transporter NTT5
UniProt Protein Name
Orphan sodium- and chloride-dependent neurotransmitter transporter NTT5
UniProt Gene Name
SLC6A16
UniProt Synonym Gene Names
NTT5
UniProt Entry Name
S6A16_HUMAN

NCBI Description

SLC6A16 shows structural characteristics of an Na(+)- and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.[supplied by OMIM, Mar 2008]

Uniprot Description

SLC6A16: Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A16 subfamily

Protein type: Transporter; Transporter, SLC family; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: integral to membrane; intracellular

Molecular Function: neurotransmitter:sodium symporter activity; neurotransmitter transporter activity

Biological Process: neurotransmitter transport; transmembrane transport

Similar Products

Product Notes

The SLC6A16 slc6a16 (Catalog #AAA6203377) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC6A16 (NTT5, Orphan Sodium-and Chloride-dependent Neurotransmitter Transporter NTT5, Solute Carrier Family 6 Member 16) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC6A16 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC6A16 slc6a16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC6A16, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.