Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human E2F1 Monoclonal Antibody | anti-E2F1 antibody

E2F1 (Transcription Factor E2F1, E2F-1, PBR3, PRB-binding Protein E2F-1, RBBP-3, Retinoblastoma-associated Protein 1, RBAP-1, Retinoblastoma-binding Protein 3, RBBP3) (MaxLight 490)

Gene Names
E2F1; RBP3; E2F-1; RBAP1; RBBP3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
E2F1; Monoclonal Antibody; E2F1 (Transcription Factor E2F1; E2F-1; PBR3; PRB-binding Protein E2F-1; RBBP-3; Retinoblastoma-associated Protein 1; RBAP-1; Retinoblastoma-binding Protein 3; RBBP3) (MaxLight 490); anti-E2F1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E10
Specificity
Recognizes human E2F1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-E2F1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa348-437 from human E2F1 (NP_005216.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-E2F1 antibody
The E2F family of transcription factors appears to play a critical role in the transcription of certain genes required for cell cycle progression. E2F1, the first cloned member of this family, is regulated during the cell cycle at the mRNA level by changes in transcription of the E2F1 gene and at the protein level by complex formation with proteins such as the retinoblastoma gene product (pRB), cyclin A and DP1. It binds to variants of the consensus sequence TTTCGCGC, found in the promoters of a number of genes important for cell cycle progression, including c-myc, cdc2, cdc6, dihydrofolate reductase, thymidine kinase, and the E2F-1 gene itself. It plays an important role in both cell cycle regulation and apoptosis. It promotes entry into S phase and stimulates cell cycle progression. It function is regulated by the retinoblastoma protein, which binds to the transactivation domain of E2F-1 and suppresses E2F-1-mediated transcriptional activation. It exhibits dual function, can stimulate cell cycle progression as an oncogene, or can promote p53-dependent apoptosis and suppress tumorigenesis as a tumor suppressor gene. Fluorescence in situ hybridization localized E2F1 to chromosome 20q11.
Product Categories/Family for anti-E2F1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,920 Da
NCBI Official Full Name
transcription factor E2F1
NCBI Official Synonym Full Names
E2F transcription factor 1
NCBI Official Symbol
E2F1
NCBI Official Synonym Symbols
RBP3; E2F-1; RBAP1; RBBP3
NCBI Protein Information
transcription factor E2F1; PBR3; RBAP-1; RBBP-3; PRB-binding protein E2F-1; retinoblastoma-binding protein 3; retinoblastoma-associated protein 1
UniProt Protein Name
Transcription factor E2F1
Protein Family
UniProt Gene Name
E2F1
UniProt Synonym Gene Names
RBBP3; E2F-1; RBAP-1; RBBP-3
UniProt Entry Name
E2F1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F2 and E2F3, have an additional cyclin binding domain. This protein binds preferentially to retinoblastoma protein pRB in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis. [provided by RefSeq, Jul 2008]

Uniprot Description

E2F1: a member of the E2F/DP family of transcription factors.The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. Binds DNA cooperatively with Dp transcription factors in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication.The Dp-1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. The E2F-1 complex binds specifically hypophosphorylated retinoblastoma protein RB1. During the cell cycle, RB1 becomes phosphorylated in mid-to-late G1 phase, detaches from the DRTF1/E2F complex, rendering E2F transcriptionally active. Phosphorylated by CDK2 and cyclin A-CDK2 in the S-phase. It can mediate both cell proliferation and p53-dependent apoptosis.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 20q11.2

Cellular Component: nucleoplasm; Rb-E2F complex; cytoplasm; nucleus

Molecular Function: protein binding; DNA binding; sequence-specific DNA binding; transcription factor binding; transcription factor activity

Biological Process: Notch signaling pathway; transcription, DNA-dependent; apoptosis; positive regulation of transcription, DNA-dependent; mRNA stabilization; negative regulation of transcription from RNA polymerase II promoter; anoikis; positive regulation of fibroblast proliferation; DNA damage response, signal transduction resulting in induction of apoptosis; regulation of transcription, DNA-dependent; DNA damage checkpoint; forebrain development; spermatogenesis; positive regulation of transcription from RNA polymerase II promoter; mitotic cell cycle; negative regulation of transcription, DNA-dependent; G1/S transition of mitotic cell cycle

Research Articles on E2F1

Similar Products

Product Notes

The E2F1 e2f1 (Catalog #AAA6200575) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The E2F1 (Transcription Factor E2F1, E2F-1, PBR3, PRB-binding Protein E2F-1, RBBP-3, Retinoblastoma-associated Protein 1, RBAP-1, Retinoblastoma-binding Protein 3, RBBP3) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's E2F1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the E2F1 e2f1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "E2F1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.