Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human AKAP17A Monoclonal Antibody | anti-AKAP17A antibody

AKAP17A (A-kinase Anchor Protein 17A, AKAP-17A, 721P, B-lymphocyte Antigen, CCDC133, CXYorf3, DXYS155E, Protein Kinase A-anchoring Protein 17A, PRKA17A, Protein XE7, RP13-297E16.1, Splicing Factor, Arginine/serine-rich 17A, SFRS17A, XE7, XE7Y) (MaxLight 4

Gene Names
AKAP17A; XE7; 721P; XE7Y; CCDC133; CXYorf3; PRKA17A; SFRS17A; AKAP-17A; DXYS155E
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AKAP17A; Monoclonal Antibody; AKAP17A (A-kinase Anchor Protein 17A; AKAP-17A; 721P; B-lymphocyte Antigen; CCDC133; CXYorf3; DXYS155E; Protein Kinase A-anchoring Protein 17A; PRKA17A; Protein XE7; RP13-297E16.1; Splicing Factor; Arginine/serine-rich 17A; SFRS17A; XE7; XE7Y) (MaxLight 4; anti-AKAP17A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2G8
Specificity
Recognizes human RP13-297E16.1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-AKAP17A antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa53-157 from RP13-297E16.1 (NP_005079) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC*
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-AKAP17A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,409 Da
NCBI Official Full Name
A-kinase anchor protein 17A isoform 1
NCBI Official Synonym Full Names
A kinase (PRKA) anchor protein 17A
NCBI Official Symbol
AKAP17A
NCBI Official Synonym Symbols
XE7; 721P; XE7Y; CCDC133; CXYorf3; PRKA17A; SFRS17A; AKAP-17A; DXYS155E
NCBI Protein Information
A-kinase anchor protein 17A; B-lymphocyte surface antigen; protein kinase A-anchoring protein 17A; pseudoautosomal gene XE7; splicing factor, arginine/serine-rich 17A
UniProt Protein Name
A-kinase anchor protein 17A
Protein Family
UniProt Gene Name
AKAP17A
UniProt Synonym Gene Names
CXYorf3; DXYS155E; SFRS17A; XE7; AKAP-17A; PRKA17A
UniProt Entry Name
AK17A_HUMAN

Uniprot Description

SFRS17A: Splice factor regulating alternative splice site selection for certain mRNA precursors. Mediates regulation of pre- mRNA splicing in a PKA-dependent manner. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA splicing

Chromosomal Location of Human Ortholog: Xp22.33 and Yp11.32

Cellular Component: nucleoplasm; spliceosome; cytoplasm; nuclear speck; nucleus

Molecular Function: protein binding; protein kinase A binding; nucleotide binding

Biological Process: B cell activation; regulation of transcription, DNA-dependent; regulation of RNA splicing; RNA splicing; signal transduction; mRNA processing

Similar Products

Product Notes

The AKAP17A akap17a (Catalog #AAA6192366) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AKAP17A (A-kinase Anchor Protein 17A, AKAP-17A, 721P, B-lymphocyte Antigen, CCDC133, CXYorf3, DXYS155E, Protein Kinase A-anchoring Protein 17A, PRKA17A, Protein XE7, RP13-297E16.1, Splicing Factor, Arginine/serine-rich 17A, SFRS17A, XE7, XE7Y) (MaxLight 4 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKAP17A can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKAP17A akap17a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKAP17A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.