Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human GATAD2A Monoclonal Antibody | anti-GATAD2A antibody

GATAD2A (Transcriptional Repressor p66-alpha, Hp66alpha, GATA Zinc Finger Domain-containing Protein 2A, FLJ20085, FLJ21017) (MaxLight 405)

Gene Names
GATAD2A; p66alpha
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GATAD2A; Monoclonal Antibody; GATAD2A (Transcriptional Repressor p66-alpha; Hp66alpha; GATA Zinc Finger Domain-containing Protein 2A; FLJ20085; FLJ21017) (MaxLight 405); anti-GATAD2A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F3
Specificity
Recognizes human GATAD2A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-GATAD2A antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa26-135 from human GATAD2A (NP_060130) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QIQKEATAQKPTGSVGSTVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSVIPPPLVRGGQQASSKLGPQASSQVVMPPLVRGAQQIHSIRQHSSTGPPPLLLAPRASVP
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GATAD2A antibody
Transcriptional repressor. Enhances MBD2-mediated repression. Efficient repression requires the presence of GATAD2B.
Product Categories/Family for anti-GATAD2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
transcriptional repressor p66-alpha isoform 2
NCBI Official Synonym Full Names
GATA zinc finger domain containing 2A
NCBI Official Symbol
GATAD2A
NCBI Official Synonym Symbols
p66alpha
NCBI Protein Information
transcriptional repressor p66-alpha
UniProt Protein Name
Transcriptional repressor p66-alpha
Protein Family
UniProt Gene Name
GATAD2A
UniProt Synonym Gene Names
Hp66alpha
UniProt Entry Name
P66A_HUMAN

Uniprot Description

GATAD2A: Transcriptional repressor. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: nucleoplasm; nuclear speck; NuRD complex; nucleus

Molecular Function: protein binding, bridging; protein binding; zinc ion binding; sequence-specific DNA binding; transcription factor activity

Biological Process: blood vessel development; embryonic body morphogenesis; neural fold formation; transcription, DNA-dependent; anterior neuropore closure; in utero embryonic development; DNA methylation; programmed cell death; negative regulation of transcription, DNA-dependent

Research Articles on GATAD2A

Similar Products

Product Notes

The GATAD2A gatad2a (Catalog #AAA6190291) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GATAD2A (Transcriptional Repressor p66-alpha, Hp66alpha, GATA Zinc Finger Domain-containing Protein 2A, FLJ20085, FLJ21017) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GATAD2A can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GATAD2A gatad2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GATAD2A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.