Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Galactokinase 1 Monoclonal Antibody | anti-GALK1 antibody

Galactokinase 1 (GALK1, Galactokinase, Galactose Kinase, GALK) (MaxLight 405)

Gene Names
GALK1; GK1; GALK; HEL-S-19
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Galactokinase 1; Monoclonal Antibody; Galactokinase 1 (GALK1; Galactokinase; Galactose Kinase; GALK) (MaxLight 405); anti-GALK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2E9
Specificity
Recognizes human GALK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-GALK1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa181-279 from human GALK1 (NP_000145) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRAR
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GALK1 antibody
Galactokinase is a major enzyme for the metabolism of galactose and its deficiency causes congenital cataracts during infancy and presenile cataracts in the adult population. GALK1 sequence shares the greatest level of conservation, 44.5% identity with that from E. coli and 34.6% amino acid identity with the product of the human GALK2 gene.
Product Categories/Family for anti-GALK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44.4 (412aa) confirmed by MALDI-TOF
NCBI Official Full Name
galactokinase
NCBI Official Synonym Full Names
galactokinase 1
NCBI Official Symbol
GALK1
NCBI Official Synonym Symbols
GK1; GALK; HEL-S-19
NCBI Protein Information
galactokinase
UniProt Protein Name
Galactokinase
UniProt Gene Name
GALK1
UniProt Synonym Gene Names
GALK
UniProt Entry Name
GALK1_HUMAN

NCBI Description

Galactokinase is a major enzyme for the metabolism of galactose and its deficiency causes congenital cataracts during infancy and presenile cataracts in the adult population. [provided by RefSeq, Jul 2008]

Uniprot Description

GALK1: Major enzyme for galactose metabolism. Defects in GALK1 are the cause of galactosemia II (GALCT2). Galactosemia II is an autosomal recessive deficiency characterized by congenital cataracts during infancy and presenile cataracts in the adult population. The cataracts are secondary to accumulation of galactitol in the lenses. Belongs to the GHMP kinase family. GalK subfamily.

Protein type: Carbohydrate Metabolism - galactose; Carbohydrate Metabolism - amino sugar and nucleotide sugar; Kinase, other; EC 2.7.1.6

Chromosomal Location of Human Ortholog: 17q24

Cellular Component: membrane; cytoplasm; cytosol

Molecular Function: galactokinase activity; galactose binding; ATP binding

Biological Process: galactose catabolic process; carbohydrate phosphorylation; carbohydrate metabolic process; galactitol metabolic process; galactose metabolic process; pathogenesis

Disease: Galactokinase Deficiency

Research Articles on GALK1

Similar Products

Product Notes

The GALK1 galk1 (Catalog #AAA6190271) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Galactokinase 1 (GALK1, Galactokinase, Galactose Kinase, GALK) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Galactokinase 1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GALK1 galk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Galactokinase 1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.