Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CCL14 Monoclonal Antibody | anti-CCL14 antibody

CCL14 (C-C Motif Chemokine 14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, Small-inducible Cytokine A14, NCC2, SCYA14) (MaxLight 405)

Gene Names
CCL14; CC-1; CC-3; CKB1; MCIF; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYL2; SCYA14; HCC-1(1-74); HCC-1/HCC-3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCL14; Monoclonal Antibody; CCL14 (C-C Motif Chemokine 14; Chemokine CC-1/CC-3; HCC-1/HCC-3; HCC-1(1-74); NCC-2; Small-inducible Cytokine A14; NCC2; SCYA14) (MaxLight 405); anti-CCL14 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F12
Specificity
Recognizes human CCL14.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
549
Applicable Applications for anti-CCL14 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa20-93 from human CCL14 (AAH45165) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CCL14 antibody
CCL14 is member of a superfamily of inducible, secreted, proinflammatory cytokines. It has weak activities on human monocytes and acts via receptors that also recognize MIP-1alpha. It also enhances the proliferation of CD34 myeloid progenitor cells. The processed form of CCL14, designated HCC-1(9-74), is a chemotactic factor that attracts monocytes, eosinophils and T cells and is a ligand for CCR1, CCR3 and CCR5.
Product Categories/Family for anti-CCL14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens chemokine (C-C motif) ligand 14, mRNA
NCBI Official Synonym Full Names
C-C motif chemokine ligand 14
NCBI Official Symbol
CCL14
NCBI Official Synonym Symbols
CC-1; CC-3; CKB1; MCIF; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYL2; SCYA14; HCC-1(1-74); HCC-1/HCC-3
NCBI Protein Information
C-C motif chemokine 14
Protein Family

NCBI Description

This gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene, chemokine (C-C motif) ligand 15, and are represented as GeneID: 348249. [provided by RefSeq, Dec 2009]

Research Articles on CCL14

Similar Products

Product Notes

The CCL14 (Catalog #AAA6189260) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CCL14 (C-C Motif Chemokine 14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, Small-inducible Cytokine A14, NCC2, SCYA14) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCL14 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCL14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCL14, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.