Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ARHGDIA Monoclonal Antibody | anti-ARHGDIA antibody

ARHGDIA (Rho GDP-dissociation Inhibitor 1, Rho GDI 1, Rho-GDI alpha, GDIA1) (MaxLight 405)

Gene Names
ARHGDIA; GDIA1; NPHS8; RHOGDI; RHOGDI-1; HEL-S-47e
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARHGDIA; Monoclonal Antibody; ARHGDIA (Rho GDP-dissociation Inhibitor 1; Rho GDI 1; Rho-GDI alpha; GDIA1) (MaxLight 405); anti-ARHGDIA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G5-2F3
Specificity
Recognizes human ARHGDIA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
1812
Applicable Applications for anti-ARHGDIA antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-204 from human ARHGDIA (AAH16031) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ARHGDIA antibody
Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.
Product Categories/Family for anti-ARHGDIA antibody
References
1. Comparative proteomic analysis on human L-02 liver cells treated with varying concentrations of trichloroethylene Liu J, Huang H, Xing X, Xi R, Zhuang Z, Yuan J, Yang F, Zhao J.Toxicol Ind Health. 2007 Mar;23(2):91-101.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
396
UniProt Accession #
NCBI Official Full Name
Homo sapiens Rho GDP dissociation inhibitor (GDI) alpha, mRNA
NCBI Official Synonym Full Names
Rho GDP dissociation inhibitor alpha
NCBI Official Symbol
ARHGDIA
NCBI Official Synonym Symbols
GDIA1; NPHS8; RHOGDI; RHOGDI-1; HEL-S-47e
NCBI Protein Information
rho GDP-dissociation inhibitor 1
UniProt Protein Name
Rho GDP-dissociation inhibitor 1
UniProt Gene Name
ARHGDIA
UniProt Synonym Gene Names
GDIA1; Rho GDI 1
UniProt Entry Name
GDIR1_HUMAN

NCBI Description

This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

RhoGDI alpha: Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Monomer. Forms a heterodimer with RAC1. Interacts with FER. Belongs to the Rho GDI family.

Protein type: Cell adhesion; G protein regulator, misc.; Apoptosis; Cell development/differentiation; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: cytoskeleton; immunological synapse; cytosol

Molecular Function: protein binding; Rho GDP-dissociation inhibitor activity; GTPase activator activity

Biological Process: regulation of small GTPase mediated signal transduction; regulation of protein localization; nerve growth factor receptor signaling pathway; small GTPase mediated signal transduction; negative regulation of axonogenesis; positive regulation of axonogenesis; negative regulation of cell adhesion; cell motility; regulation of axonogenesis; negative regulation of cell migration; Rho protein signal transduction; negative regulation of apoptosis; positive regulation of GTPase activity

Disease: Nephrotic Syndrome, Type 8

Research Articles on ARHGDIA

Similar Products

Product Notes

The ARHGDIA arhgdia (Catalog #AAA6188911) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARHGDIA (Rho GDP-dissociation Inhibitor 1, Rho GDI 1, Rho-GDI alpha, GDIA1) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGDIA can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARHGDIA arhgdia for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARHGDIA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.