Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human APOER2 Monoclonal Antibody | anti-APOER2 antibody

APOER2 (Low Density Lipoprotein Receptor-related Protein 8, LRP-8, Apolipoprotein E Receptor 2, LRP8) (MaxLight 405)

Gene Names
LRP8; MCI1; LRP-8; APOER2; HSZ75190
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
APOER2; Monoclonal Antibody; APOER2 (Low Density Lipoprotein Receptor-related Protein 8; LRP-8; Apolipoprotein E Receptor 2; LRP8) (MaxLight 405); anti-APOER2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3H2
Specificity
Recognizes human LRP8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
963
Applicable Applications for anti-APOER2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa83-171 from LRP8 (NP_004622) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH*
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-APOER2 antibody
LPR8 is an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL). The apolipoprotein E receptor is involved in cellular recognition and internalization of these lipoproteins.
Product Categories/Family for anti-APOER2 antibody
References
1. PCSK9 is not involved in the degradation of LDL receptors and BACE1 in the adult mouse brain. Liu M, Wu G, Baysarowich J, Kavana M, Addona GH, Bierilo KK, Mudgett JS, Pavlovic G, Sitlani A, Renger JJ, Hubbard BK, Fisher TS, Zerbinatti CV.J Lipid Res. 2010 Sep;51(9):2611-8. Epub 2010 May 7.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
low-density lipoprotein receptor-related protein 8 isoform 1
NCBI Official Synonym Full Names
LDL receptor related protein 8
NCBI Official Symbol
LRP8
NCBI Official Synonym Symbols
MCI1; LRP-8; APOER2; HSZ75190
NCBI Protein Information
low-density lipoprotein receptor-related protein 8
UniProt Protein Name
Low-density lipoprotein receptor-related protein 8
UniProt Gene Name
LRP8
UniProt Synonym Gene Names
APOER2; LRP-8
UniProt Entry Name
LRP8_HUMAN

NCBI Description

This gene encodes a member of the low density lipoprotein receptor (LDLR) family. Low density lipoprotein receptors are cell surface proteins that play roles in both signal transduction and receptor-mediated endocytosis of specific ligands for lysosomal degradation. The encoded protein plays a critical role in the migration of neurons during development by mediating Reelin signaling, and also functions as a receptor for the cholesterol transport protein apolipoprotein E. Expression of this gene may be a marker for major depressive disorder. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jun 2011]

Uniprot Description

LRP8: Cell surface receptor for Reelin (RELN) and apolipoprotein E (apoE)-containing ligands. LRP8 participates in transmitting the extracellular Reelin signal to intracellular signaling processes, by binding to DAB1 on its cytoplasmic tail. Reelin acts via both the VLDL receptor (VLDLR) and LRP8 to regulate DAB1 tyrosine phosphorylation and microtubule function in neurons. LRP8 has higher affinity for Reelin than VLDLR. LRP8 is thus a key component of the Reelin pathway which governs neuronal layering of the forebrain during embryonic brain development. Binds the endoplasmic reticulum resident receptor-associated protein (RAP). Binds dimers of beta 2-glycoprotein I and may be involved in the suppression of platelet aggregation in the vasculature. Highly expressed in the initial segment of the epididymis, where it affects the functional expression of clusterin and phospholipid hydroperoxide glutathione peroxidase (PHGPx), two proteins required for sperm maturation. May also function as an endocytic receptor. Defects in LRP8 are a cause of myocardial infarction type 1 (MCI1). A condition defined by the irreversible necrosis of heart muscle secondary to prolonged ischemia. Belongs to the LDLR family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p34

Cellular Component: microtubule associated complex; membrane; cell soma; axon; dendrite; postsynaptic density; extracellular region; integral to membrane; plasma membrane; caveola; receptor complex

Molecular Function: very-low-density lipoprotein receptor activity; protein binding; transmembrane receptor activity; kinesin binding; apolipoprotein binding; calcium ion binding; high-density lipoprotein binding

Biological Process: regulation of synaptic transmission; response to drug; receptor-mediated endocytosis; phototransduction, visible light; cytokine and chemokine mediated signaling pathway; activation of CREB transcription factor; endocytosis; negative regulation of transcription from RNA polymerase II promoter; signal transduction; proteolysis; ammon gyrus development; positive regulation of peptidyl-tyrosine phosphorylation; lipid metabolic process; retinoid metabolic process; blood coagulation; layer formation in the cerebral cortex

Disease: Myocardial Infarction, Susceptibility To

Research Articles on APOER2

Similar Products

Product Notes

The APOER2 lrp8 (Catalog #AAA6188894) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The APOER2 (Low Density Lipoprotein Receptor-related Protein 8, LRP-8, Apolipoprotein E Receptor 2, LRP8) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOER2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the APOER2 lrp8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APOER2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.