Mouse MAP2K2 Monoclonal Antibody | anti-MAP2K2 antibody

MAP2K2 (Mitogen-Activated Protein Kinase Kinase 2, FLJ26075, MAPKK2, MEK2, MKK2, PRKMK2) (PE)

Cat. Num. AAA6187464

• Gene Names: MAP2K2; CFC4; MEK2; MKK2; MAPKK2; PRKMK2
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: MAP2K2; Monoclonal Antibody; MAP2K2 (Mitogen-Activated Protein Kinase Kinase 2; FLJ26075; MAPKK2; MEK2; MKK2; PRKMK2) (PE); Mitogen-Activated Protein Kinase Kinase 2; PRKMK2; anti-MAP2K2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 8D10
• Specificity: Recognizes MAP2K2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 400

• Applicable Applications for anti-MAP2K2 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MAP2K2 (AAH00471, 1aa-360aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMAPERLQGTHYSVQSDIWSMGLSLVELAVGRYPIPPPDAKELEAIFGRPVVDGEEGEPHSISPRPRPPGRPVSGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTPDFQEFVNKCLIKNPAERADL
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MAP2K2 expression in transfected 293T cell line by MAP2K2 monoclonal antibody (M11), clone 8D10.Lane 1: MAP2K2 transfected lysate (Predicted MW: 44.4 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged MAP2K2 is 0.3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAP2K2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAP2K2 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-MAP2K2 antibody

The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in this gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene. [provided by RefSeq]

Product Categories/Family for anti-MAP2K2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 12653403
• NCBI GeneID: 5605
• NCBI Official Full Name: Mitogen-activated protein kinase kinase 2
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase 2
• NCBI Official Symbol: MAP2K2
• NCBI Official Synonym Symbols: CFC4; MEK2; MKK2; MAPKK2; PRKMK2
• NCBI Protein Information: dual specificity mitogen-activated protein kinase kinase 2
• Protein Family: Dual specificity mitogen-activated protein kinase kinase

NCBI Description

The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in this gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, cognitive disability, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene. [provided by RefSeq, Jul 2008]