Testing Data
(Detection limit for recombinant GST tagged ENTPD3 is 1 ng/ml as a capture antibody.)
Mouse ENTPD3 Monoclonal Antibody | anti-ENTPD3 antibody
ENTPD3 (Ectonucleoside Triphosphate Diphosphohydrolase 3, CD39L3, FLJ93839, HB6, NTPDase-3) (PE)
Gene Names
ENTPD3; HB6; CD39L3; NTPDase-3
Applications
ELISA
Purity
Purified
Synonyms
ENTPD3; Monoclonal Antibody; ENTPD3 (Ectonucleoside Triphosphate Diphosphohydrolase 3; CD39L3; FLJ93839; HB6; NTPDase-3) (PE); Ectonucleoside Triphosphate Diphosphohydrolase 3; NTPDase-3; anti-ENTPD3 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A4
Specificity
Recognizes ENTPD3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ENTPD3 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ENTPD3 (NP_001239, 107aa-216aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTG
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged ENTPD3 is 1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ENTPD3 is 1 ng/ml as a capture antibody.)
Related Product Information for anti-ENTPD3 antibody
ENTPD3 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD3 contains 4 apyrase-conserved regions which is characteristic of NTPases. [provided by RefSeq]
Product Categories/Family for anti-ENTPD3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52.0 kDa (465aa)
NCBI Official Full Name
ectonucleoside triphosphate diphosphohydrolase 3 isoform 1
NCBI Official Synonym Full Names
ectonucleoside triphosphate diphosphohydrolase 3
NCBI Official Symbol
ENTPD3
NCBI Official Synonym Symbols
HB6; CD39L3; NTPDase-3
NCBI Protein Information
ectonucleoside triphosphate diphosphohydrolase 3
UniProt Protein Name
Ectonucleoside triphosphate diphosphohydrolase 3
Protein Family
UniProt Gene Name
ENTPD3
UniProt Synonym Gene Names
CD39L3; NTPDase 3; Ecto-ATPDase 3; Ecto-ATPase 3
UniProt Entry Name
ENTP3_HUMAN
NCBI Description
This gene encodes a plasma membrane-bound divalent cation-dependent E-type nucleotidase. The encoded protein is involved in the regulation of extracellular levels of ATP by hydrolysis of it and other nucleotides. Multiple transcript variants have been described. [provided by RefSeq, May 2014]
Uniprot Description
ENTPD3: Has a threefold preference for the hydrolysis of ATP over ADP. Belongs to the GDA1/CD39 NTPase family.
Protein type: EC 3.6.1.5; Hydrolase; Membrane protein, integral; Membrane protein, multi-pass; Nucleotide Metabolism - purine; Nucleotide Metabolism - pyrimidine; Phosphatase (non-protein)
Chromosomal Location of Human Ortholog: 3p21.3
Molecular Function: protein binding
Research Articles on ENTPD3
Similar Products
Product Notes
The ENTPD3 entpd3 (Catalog #AAA6187375) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ENTPD3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ENTPD3 entpd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ENTPD3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
