Mouse GRP Monoclonal Antibody | anti-GRP antibody

GRP (gastrin-releasing peptide, BN, GRP-10, preproGRP, proGRP) (PE)

Cat. Num. AAA6187337

• Gene Names: GRP; BN; GRP-10; proGRP; preproGRP
• Applications: Western Blot
• Purity: Purified
• Synonyms: GRP; Monoclonal Antibody; GRP (gastrin-releasing peptide; BN; GRP-10; preproGRP; proGRP) (PE); gastrin-releasing peptide; proGRP; anti-GRP antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3A11
• Specificity: Recognizes GRP.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 148

• Applicable Applications for anti-GRP antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: GRP (AAH04488, 1aa-148aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GRP expression in transfected 293T cell line by GRP monoclonal antibody (M03), clone 3A11.Lane 1: GRP transfected lysate (16.39 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged GRP is 3 ng/ml as a capture antibody.)

Related Product Information for anti-GRP antibody

This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. Its preproprotein, following cleavage of a signal peptide, is further processed to produce either the 27 aa gastrin-releasing peptide or the 10 aa neuromedin C. These smaller peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Product Categories/Family for anti-GRP antibody

Antibodies; Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 13325358
• NCBI GeneID: 2922
• NCBI Official Full Name: Gastrin-releasing peptide
• NCBI Official Synonym Full Names: gastrin releasing peptide
• NCBI Official Symbol: GRP
• NCBI Official Synonym Symbols: BN; GRP-10; proGRP; preproGRP
• NCBI Protein Information: gastrin-releasing peptide
• Protein Family: GrpE protein

NCBI Description

This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. The encoded preproprotein is proteolytically processed to generate two peptides, gastrin-releasing peptide and neuromedin-C. These peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]