Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (USP14 monoclonal antibody (M08), clone 1F8. Western Blot analysis of USP14 expression in Hela S3 NE (Cat # L013V3).)

Mouse USP14 Monoclonal Antibody | anti-USP14 antibody

USP14 (Ubiquitin Specific Peptidase 14 (tRNA-Guanine transglycosylase), TGT) (PE)

Gene Names
USP14; TGT
Applications
Western Blot
Purity
Purified
Synonyms
USP14; Monoclonal Antibody; USP14 (Ubiquitin Specific Peptidase 14 (tRNA-Guanine transglycosylase); TGT) (PE); Ubiquitin Specific Peptidase 14 (tRNA-Guanine transglycosylase); TGT; anti-USP14 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F8
Specificity
Recognizes USP14.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-USP14 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
USP14 (NP_005142, 395aa-494aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(USP14 monoclonal antibody (M08), clone 1F8. Western Blot analysis of USP14 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (USP14 monoclonal antibody (M08), clone 1F8. Western Blot analysis of USP14 expression in Hela S3 NE (Cat # L013V3).)

Testing Data

(Detection limit for recombinant GST tagged USP14 is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged USP14 is approximately 1ng/ml as a capture antibody.)

Western Blot (WB)

(USP14 monoclonal antibody (M08), clone 1F8. Western Blot analysis of USP14 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB) (USP14 monoclonal antibody (M08), clone 1F8. Western Blot analysis of USP14 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB)

(USP14 monoclonal antibody (M08), clone 1F8. Western Blot analysis of USP14 expression in PC-12 (Cat # L012V1).)

Western Blot (WB) (USP14 monoclonal antibody (M08), clone 1F8. Western Blot analysis of USP14 expression in PC-12 (Cat # L012V1).)

Western Blot (WB)

(USP14 monoclonal antibody (M08), clone 1F8. Western Blot analysis of USP14 expression in Raw 264.7 (Cat # L024V1).)

Western Blot (WB) (USP14 monoclonal antibody (M08), clone 1F8. Western Blot analysis of USP14 expression in Raw 264.7 (Cat # L024V1).)
Related Product Information for anti-USP14 antibody
This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]
Product Categories/Family for anti-USP14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58.5 kDa (517aa)
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 14 isoform a
NCBI Official Synonym Full Names
ubiquitin specific peptidase 14
NCBI Official Symbol
USP14
NCBI Official Synonym Symbols
TGT
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 14
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 14
UniProt Gene Name
USP14
UniProt Synonym Gene Names
TGT
UniProt Entry Name
UBP14_HUMAN

NCBI Description

This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

USP14: Proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. Ensures the regeneration of ubiquitin at the proteasome. Is a reversibly associated subunit of the proteasome and a large fraction of proteasome-free protein exists within the cell. Required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Serves also as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under the non-stressed condition by inhibiting the degradation of unfolded endoplasmic reticulum proteins via interaction with ERN1. Indispensable for synaptic development and function at neuromuscular junctions (NMJs). Homodimer (Potential). Associates with the 26S proteasome. Interacts with FANCC, CXCR4 and ERN1. Belongs to the peptidase C19 family. USP14/UBP6 subfamily.

Protein type: Protease; Ubiquitin conjugating system; Ubiquitin-specific protease; EC 3.4.19.12

Chromosomal Location of Human Ortholog: 18p11.32

Cellular Component: proteasome complex; cell surface; cytoplasm; cytoplasmic membrane-bound vesicle; plasma membrane; synapse; nucleus

Molecular Function: protein binding; tRNA guanylyltransferase activity; cysteine-type endopeptidase activity; ubiquitin-specific protease activity; endopeptidase inhibitor activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; synaptic transmission; protein deubiquitination; regulation of chemotaxis

Research Articles on USP14

Similar Products

Product Notes

The USP14 usp14 (Catalog #AAA6185824) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's USP14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the USP14 usp14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "USP14, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.