Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SIX4 monoclonal antibody (M09), clone 7E2 Western Blot analysis of SIX4 expression in Hela S3 NE (Cat # L013V3).)

Mouse SIX4 Monoclonal Antibody | anti-SIX4 antibody

SIX4 (SIX Homeobox 4, AREC3, MGC119450, MGC119452, MGC119453) (PE)

Gene Names
SIX4; AREC3
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
SIX4; Monoclonal Antibody; SIX4 (SIX Homeobox 4; AREC3; MGC119450; MGC119452; MGC119453) (PE); SIX Homeobox 4; MGC119453; anti-SIX4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
700
Specificity
Recognizes SIX4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SIX4 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SIX4 (NP_059116, 672aa-780aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GQDLLSVPMTQAALGEIVPTAEDQVGHPSPAVHQDFVQEHRLVLQSVANMKENFLSNSESKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDEDMQD
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SIX4 monoclonal antibody (M09), clone 7E2 Western Blot analysis of SIX4 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (SIX4 monoclonal antibody (M09), clone 7E2 Western Blot analysis of SIX4 expression in Hela S3 NE (Cat # L013V3).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SIX4 on HeLa cell. [antibody concentration 15 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SIX4 on HeLa cell. [antibody concentration 15 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SIX4 on HeLa cell. [antibody concentration 15 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SIX4 on HeLa cell. [antibody concentration 15 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SIX4 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SIX4 is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-SIX4 antibody
Mouse monoclonal antibody raised against a partial recombinant SIX4.
Product Categories/Family for anti-SIX4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
homeobox protein SIX4
NCBI Official Synonym Full Names
SIX homeobox 4
NCBI Official Symbol
SIX4
NCBI Official Synonym Symbols
AREC3
NCBI Protein Information
homeobox protein SIX4
UniProt Protein Name
Homeobox protein SIX4
Protein Family
UniProt Gene Name
SIX4
UniProt Entry Name
SIX4_HUMAN

NCBI Description

This gene encodes a member of the homeobox family, subfamily SIX. The drosophila homolog is a nuclear homeoprotein required for eye development. Studies in mouse show that this gene product functions as a transcription factor, and may have a role in the differentiation or maturation of neuronal cells. [provided by RefSeq, May 2010]

Uniprot Description

SIX4: a member of the homeobox family, subfamily SIX. The drosophila homolog is a nuclear homeoprotein required for eye development. Studies in mouse show that this gene product functions as a transcription factor, and may have a role in the differentiation or maturation of neuronal cells. [provided by RefSeq, May 2010]

Protein type: Cell development/differentiation; Transcription factor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 14q23

Cellular Component: cytoplasm; nucleus

Molecular Function: sequence-specific DNA binding; transcription factor activity

Biological Process: tongue development; anatomical structure morphogenesis; skeletal muscle development; inner ear morphogenesis; pharyngeal system development; transcription, DNA-dependent; thymus development; positive regulation of transcription, DNA-dependent; male gonad development; embryonic cranial skeleton morphogenesis; sarcomere organization; olfactory placode formation; regulation of epithelial cell proliferation; male sex differentiation; regulation of protein localization; generation of neurons; male sex determination; myoblast migration; regulation of synaptic growth at neuromuscular junction; positive regulation of transcription from RNA polymerase II promoter; negative regulation of neuron apoptosis; negative regulation of transcription, DNA-dependent; negative regulation of apoptosis

Research Articles on SIX4

Similar Products

Product Notes

The SIX4 six4 (Catalog #AAA6185345) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SIX4 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SIX4 six4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SIX4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.