Mouse TAF11 Monoclonal Antibody | anti-TAF11 antibody

TAF11 (TAF11 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 28kD, MGC:15243, PRO2134, TAF2I, TAFII28) (PE)

Cat. Num. AAA6184746

• Gene Names: TAF11; TAF2I; PRO2134; TAFII28; MGC:15243
• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: TAF11; Monoclonal Antibody; TAF11 (TAF11 RNA Polymerase II; TATA Box Binding Protein (TBP)-Associated Factor; 28kD; MGC:15243; PRO2134; TAF2I; TAFII28) (PE); TAF11 RNA Polymerase II; TAFII28; anti-TAF11 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3H5
• Specificity: Recognizes TAF11.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-TAF11 antibody: Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TAF11 (NP_005634, 158aa-210aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TAF11 monoclonal antibody (M03), clone 3H5 Western Blot analysis of TAF11 expression in Hela S3 NE (Cat # L013V3).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TAF11 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TAF11 on HeLa cell. [antibody concentration 10 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TAF11 is approximately 0.1ng/ml as a capture antibody.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TAF11 on formalin-fixed paraffin-embedded human smooth muscle. [antibody concentration 1.2 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TAF11 on formalin-fixed paraffin-embedded human smooth muscle. [antibody concentration 1.2 ug/ml])

Related Product Information for anti-TAF11 antibody

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit of TFIID that is present in all TFIID complexes and interacts with TBP. This subunit also interacts with another small subunit, TAF13, to form a heterodimer with a structure similar to the histone core structure. [provided by RefSeq]

Product Categories/Family for anti-TAF11 antibody

Antibodies; Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 5032151
• NCBI GeneID: 6882
• NCBI Accession #: NP_005634
• NCBI GenBank Nucleotide #: NM_005643
• UniProt Accession #: Q15544
• Molecular Weight: 23kDa
• NCBI Official Full Name: transcription initiation factor TFIID subunit 11 isoform 1
• NCBI Official Synonym Full Names: TATA-box binding protein associated factor 11
• NCBI Official Symbol: TAF11
• NCBI Official Synonym Symbols: TAF2I; PRO2134; TAFII28; MGC:15243
• NCBI Protein Information: transcription initiation factor TFIID subunit 11
• UniProt Protein Name: Transcription initiation factor TFIID subunit 11
• Protein Family: Transcription initiation factor
• UniProt Gene Name: TAF11
• UniProt Synonym Gene Names: TAF2I
• UniProt Entry Name: TAF11_HUMAN

NCBI Description

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit of TFIID that is present in all TFIID complexes and interacts with TBP. This subunit also interacts with another small subunit, TAF13, to form a heterodimer with a structure similar to the histone core structure. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012]