Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TNFRSF11A monoclonal antibody (M39), clone 2G2. Western Blot analysis of TNFRSF11A expression in K-562.)

Mouse TNFRSF11A Monoclonal Antibody | anti-TNFRSF11A antibody

TNFRSF11A (Tumor Necrosis Factor Receptor Superfamily, Member 11a, NFKB Activator, CD265, FEO, LOH18CR1, ODFR, OFE, OPTB7, OSTS, PDB2, RANK, TRANCER) (HRP)

Gene Names
TNFRSF11A; FEO; OFE; ODFR; OSTS; PDB2; RANK; CD265; OPTB7; TRANCER; LOH18CR1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
TNFRSF11A; Monoclonal Antibody; TNFRSF11A (Tumor Necrosis Factor Receptor Superfamily; Member 11a; NFKB Activator; CD265; FEO; LOH18CR1; ODFR; OFE; OPTB7; OSTS; PDB2; RANK; TRANCER) (HRP); Tumor Necrosis Factor Receptor Superfamily; TRANCER; anti-TNFRSF11A antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G2
Specificity
Recognizes TNFRSF11A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-TNFRSF11A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TNFRSF11A (NP_003830.1, 31aa-130aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
APPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRN
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TNFRSF11A monoclonal antibody (M39), clone 2G2. Western Blot analysis of TNFRSF11A expression in K-562.)

Western Blot (WB) (TNFRSF11A monoclonal antibody (M39), clone 2G2. Western Blot analysis of TNFRSF11A expression in K-562.)

Western Blot (WB)

(TNFRSF11A monoclonal antibody (M39), clone 2G2. Western Blot analysis of TNFRSF11A expression in Raw 264.7.)

Western Blot (WB) (TNFRSF11A monoclonal antibody (M39), clone 2G2. Western Blot analysis of TNFRSF11A expression in Raw 264.7.)

Western Blot (WB)

(TNFRSF11A monoclonal antibody (M39), clone 2G2. Western Blot analysis of TNFRSF11A expression in PC-12.)

Western Blot (WB) (TNFRSF11A monoclonal antibody (M39), clone 2G2. Western Blot analysis of TNFRSF11A expression in PC-12.)

Testing Data

(Detection limit for recombinant GST tagged TNFRSF11A is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TNFRSF11A is 0.03 ng/ml as a capture antibody.)
Product Categories/Family for anti-TNFRSF11A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,552 Da
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 11A isoform 1
NCBI Official Synonym Full Names
tumor necrosis factor receptor superfamily, member 11a, NFKB activator
NCBI Official Symbol
TNFRSF11A
NCBI Official Synonym Symbols
FEO; OFE; ODFR; OSTS; PDB2; RANK; CD265; OPTB7; TRANCER; LOH18CR1
NCBI Protein Information
tumor necrosis factor receptor superfamily member 11A; Paget disease of bone 2; receptor activator of NF-KB; osteoclast differentiation factor receptor; receptor activator of nuclear factor-kappa B; loss of heterozygosity, 18, chromosomal region 1
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 11A
UniProt Gene Name
TNFRSF11A
UniProt Synonym Gene Names
RANK; ODFR
UniProt Entry Name
TNR11_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptors can interact with various TRAF family proteins, through which this receptor induces the activation of NF-kappa B and MAPK8/JNK. This receptor and its ligand are important regulators of the interaction between T cells and dendritic cells. This receptor is also an essential mediator for osteoclast and lymph node development. Mutations at this locus have been associated with familial expansile osteolysis, autosomal recessive osteopetrosis, and Paget disease of bone. Alternatively spliced transcript variants have been described for this locus. [provided by RefSeq, Aug 2012]

Uniprot Description

TNFRSF11A: Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis. Involved in the regulation of interactions between T-cells and dendritic cells. Binds to the clefts between the subunits of the TNFSF11 ligand trimer to form a heterohexamer. Interacts with TRAF1, TRAF2, TRAF3, TRAF5 and TRAF6. Interacts (via cytoplasmic domain) with GAB2. Ubiquitous expression with high levels in skeletal muscle, thymus, liver, colon, small intestine and adrenal gland.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 18q22.1

Cellular Component: external side of plasma membrane; integral to plasma membrane; plasma membrane

Molecular Function: cytokine binding; protein binding; receptor activity; transmembrane receptor activity; tumor necrosis factor receptor activity

Biological Process: activation of NF-kappaB transcription factor; adaptive immune response; cell-cell signaling; circadian thermoregulation; inflammatory response; osteoclast differentiation; positive regulation of cell proliferation; positive regulation of JNK activity; positive regulation of transcription factor activity; regulation of apoptosis; response to cytokine stimulus; response to lipopolysaccharide; signal transduction; tumor necrosis factor-mediated signaling pathway

Disease: Familial Expansile Osteolysis; Osteopetrosis, Autosomal Recessive 7; Paget Disease Of Bone

Research Articles on TNFRSF11A

Similar Products

Product Notes

The TNFRSF11A tnfrsf11a (Catalog #AAA6183508) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TNFRSF11A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TNFRSF11A tnfrsf11a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TNFRSF11A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.