Mouse SGCD Monoclonal Antibody | anti-SGCD antibody

SGCD (Sarcoglycan, delta (35kD Dystrophin-Associated Glycoprotein), 35DAG, CMD1L, DAGD, MGC22567, SG-delta, SGCDP, SGD) (HRP)

Cat. Num. AAA6183434

• Gene Names: SGCD; SGD; DAGD; 35DAG; CMD1L; SGCDP; SG-delta
• Applications: Western Blot
• Purity: Purified
• Synonyms: SGCD; Monoclonal Antibody; SGCD (Sarcoglycan; delta (35kD Dystrophin-Associated Glycoprotein); 35DAG; CMD1L; DAGD; MGC22567; SG-delta; SGCDP; SGD) (HRP); Sarcoglycan; SGD; anti-SGCD antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3G10
• Specificity: Recognizes SGCD.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-SGCD antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SGCD (NP_000328.2, 114aa-189aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ILNDQTKVLTQLITGPKAVEAYGKKFEVKTVSGKLLFSADNNEVVVGAERLRVLGAEGTVFPKSIETPNVRADPFK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SGCD is 0.03 ng/ml as a capture antibody.)

Product Categories/Family for anti-SGCD antibody

Antibodies; Carbohydrates; Glycoproteins

NCBI and Uniprot Product Information

• NCBI GI #: 21314619
• NCBI GeneID: 6444
• NCBI Accession #: NP_000328.2
• NCBI GenBank Nucleotide #: NM_000337.5
• UniProt Accession #: Q92629; Q53XA5; Q99644; A8K9S9
• Molecular Weight: 28,750 Da
• NCBI Official Full Name: delta-sarcoglycan isoform 1
• NCBI Official Synonym Full Names: sarcoglycan, delta (35kDa dystrophin-associated glycoprotein)
• NCBI Official Symbol: SGCD
• NCBI Official Synonym Symbols: SGD; DAGD; 35DAG; CMD1L; SGCDP; SG-delta
• NCBI Protein Information: delta-sarcoglycan; 35 kDa dystrophin-associated glycoprotein; delta-SG; dystrophin associated glycoprotein, delta sarcoglycan; placental delta sarcoglycan
• UniProt Protein Name: Delta-sarcoglycan
• Protein Family: Delta-sarcoglycan
• UniProt Gene Name: SGCD
• UniProt Synonym Gene Names: Delta-SG; 35DAG
• UniProt Entry Name: SGCD_HUMAN

NCBI Description

The protein encoded by this gene is one of the four known components of the sarcoglycan complex, which is a subcomplex of the dystrophin-glycoprotein complex (DGC). DGC forms a link between the F-actin cytoskeleton and the extracellular matrix. This protein is expressed most abundantly in skeletal and cardiac muscle. Mutations in this gene have been associated with autosomal recessive limb-girdle muscular dystrophy and dilated cardiomyopathy. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SGCD: Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix. Defects in SGCD are the cause of limb-girdle muscular dystrophy type 2F (LGMD2F). LGMD2F is an autosomal recessive disorder. Defects in SGCD are the cause of cardiomyopathy dilated type 1L (CMD1L). Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. Belongs to the sarcoglycan beta/delta/gamma/zeta family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Dystrophin complex

Chromosomal Location of Human Ortholog: 5q33-q34

Cellular Component: dystrophin-associated glycoprotein complex; cytoskeleton; cytoplasm; integral to membrane; plasma membrane; sarcoglycan complex; sarcolemma

Biological Process: cardiac muscle development; muscle development; heart contraction; muscle cell development

Disease: Muscular Dystrophy, Limb-girdle, Type 2f; Cardiomyopathy, Dilated, 1l