Mouse SLC2A4 Monoclonal Antibody | anti-SLC2A4 antibody

SLC2A4 (Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 4, GLUT4) (HRP)

Cat. Num. AAA6182789

• Gene Names: SLC2A4; GLUT4
• Applications: Western Blot
• Purity: Purified
• Synonyms: SLC2A4; Monoclonal Antibody; SLC2A4 (Solute Carrier Family 2 (Facilitated Glucose Transporter); Member 4; GLUT4) (HRP); Solute Carrier Family 2 (Facilitated Glucose Transporter); GLUT4; anti-SLC2A4 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1G9
• Specificity: Recognizes SLC2A4.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-SLC2A4 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SLC2A4 (NP_001033, 467aa-509aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SLC2A4 is 1 ng/ml as a capture antibody.)

Product Categories/Family for anti-SLC2A4 antibody

Antibodies; Transport Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4507011
• NCBI GeneID: 6517
• NCBI Accession #: NP_001033
• NCBI GenBank Nucleotide #: NM_001042
• UniProt Accession #: P14672
• Molecular Weight: 55kDa
• NCBI Official Full Name: solute carrier family 2, facilitated glucose transporter member 4
• NCBI Official Synonym Full Names: solute carrier family 2 member 4
• NCBI Official Symbol: SLC2A4
• NCBI Official Synonym Symbols: GLUT4
• NCBI Protein Information: solute carrier family 2, facilitated glucose transporter member 4
• UniProt Protein Name: Solute carrier family 2, facilitated glucose transporter member 4
• Protein Family: SLC2A4 regulator
• UniProt Gene Name: SLC2A4
• UniProt Synonym Gene Names: GLUT4; GLUT-4
• UniProt Entry Name: GTR4_HUMAN

NCBI Description

This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq, Jul 2008]

Uniprot Description

GLUT4: an integral membrane facilitative glucose transporter. One of 13 members of the human equilibrative glucose transport protein family. Its surface expression is regulated by insulin. Has two internalization sequences, a dileucine repeat present in the C-terminus and a FxxY motif in the amino-terminal end. Associates with an intracellular tubulo-vesicular compartment under low plasma conditions. The binding of insulin to the insulin receptor (a typosine kinase) leads to the rapid translocation of GLUT4 to the cell surface, increasing cellular glucose transport activity. Its translocation to the plasma membrane is also stimulated by exercise, but independent from insulin signaling. This insulin-independent pathway may be regulated by AMPK.

Protein type: Transporter, SLC family; Transporter; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: multivesicular body; trans-Golgi network transport vesicle; membrane; clathrin-coated vesicle; integral to plasma membrane; perinuclear region of cytoplasm; T-tubule; plasma membrane; endomembrane system; coated pit; vesicle membrane; cytosol; lipid raft; external side of plasma membrane

Molecular Function: D-glucose transmembrane transporter activity; protein binding; glucose transmembrane transporter activity

Biological Process: amylopectin biosynthetic process; response to ethanol; cellular response to insulin stimulus; glucose import; hexose transport; carbohydrate metabolic process; brown fat cell differentiation; pathogenesis; glucose transport; glucose homeostasis; transmembrane transport

Disease: Diabetes Mellitus, Noninsulin-dependent