Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged RAD1 is approximately 1ng/ml as a capture antibody.)

Mouse RAD1 Monoclonal Antibody | anti-RAD1 antibody

RAD1 (RAD1 Homolog (S. pombe), HRAD1, REC1) (HRP)

Gene Names
RAD1; REC1; HRAD1
Applications
Western Blot
Purity
Purified
Synonyms
RAD1; Monoclonal Antibody; RAD1 (RAD1 Homolog (S. pombe); HRAD1; REC1) (HRP); RAD1 Homolog (S. pombe); REC1; anti-RAD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1A12
Specificity
Recognizes RAD1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
282
Applicable Applications for anti-RAD1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RAD1 (AAH06837, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIFQEFKVQEESVTFRINLTVLL
Conjugate
HRP
Preparation and Storage
May be stored at 4 degree C. For long-term storage, aliquot and store at 4 degree C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RAD1 is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RAD1 is approximately 1ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of RAD1 expression in transfected 293T cell line by RAD1 monoclonal antibody (M04), clone 1A12.Lane 1: RAD1 transfected lysate (Predicted MW: 31.8 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RAD1 expression in transfected 293T cell line by RAD1 monoclonal antibody (M04), clone 1A12.Lane 1: RAD1 transfected lysate (Predicted MW: 31.8 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-RAD1 antibody
This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described. [provided by RefSeq]
Product Categories/Family for anti-RAD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
RAD1 homolog (S. pombe)
NCBI Official Synonym Full Names
RAD1 checkpoint DNA exonuclease
NCBI Official Symbol
RAD1
NCBI Official Synonym Symbols
REC1; HRAD1
NCBI Protein Information
cell cycle checkpoint protein RAD1
Protein Family

NCBI Description

This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Jan 2009]

Research Articles on RAD1

Similar Products

Product Notes

The RAD1 (Catalog #AAA6181721) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RAD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAD1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.