Mouse FZD2 Monoclonal Antibody | anti-FZD2 antibody

FZD2 (Frizzled Homolog 2 (Drosophila)) (HRP)

Cat. Num. AAA6181548

• Gene Names: FZD2; Fz2; fz-2; fzE2; hFz2; OMOD2
• Applications: ELISA
• Purity: Purified
• Synonyms: FZD2; Monoclonal Antibody; FZD2 (Frizzled Homolog 2 (Drosophila)) (HRP); Frizzled Homolog 2 (Drosophila); anti-FZD2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 10000000
• Specificity: Recognizes FZD2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-FZD2 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: FZD2 (NP_001457, 192aa-245aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FZD2 is approximately 1ng/ml as a capture antibody.)

Product Categories/Family for anti-FZD2 antibody

Antibodies; Wnt Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4503827
• NCBI GeneID: 2535
• NCBI Accession #: NP_001457
• NCBI GenBank Nucleotide #: NM_001466
• UniProt Accession #: Q14332
• Molecular Weight: 63kDa
• NCBI Official Full Name: frizzled-2
• NCBI Official Synonym Full Names: frizzled class receptor 2
• NCBI Official Symbol: FZD2
• NCBI Official Synonym Symbols: Fz2; fz-2; fzE2; hFz2; OMOD2
• NCBI Protein Information: frizzled-2
• UniProt Protein Name: Frizzled-2
• UniProt Gene Name: FZD2
• UniProt Synonym Gene Names: Fz-2; hFz2
• UniProt Entry Name: FZD2_HUMAN

NCBI Description

This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. This gene encodes a protein that is coupled to the beta-catenin canonical signaling pathway. Competition between the wingless-type MMTV integration site family, member 3A and wingless-type MMTV integration site family, member 5A gene products for binding of this protein is thought to regulate the beta-catenin-dependent and -independent pathways. [provided by RefSeq, Dec 2010]

Uniprot Description

FZD2: Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK- 3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Belongs to the G-protein coupled receptor Fz/Smo family.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Receptor, GPCR; GPCR, Fz/Smo family; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17q21.1

Cellular Component: focal adhesion; cytoplasm; integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; Wnt-protein binding; Wnt receptor activity; PDZ domain binding

Biological Process: neuron differentiation; G-protein coupled receptor protein signaling pathway; cell-cell signaling; epithelial cell differentiation; inner ear receptor cell development; positive regulation of transcription, DNA-dependent; sensory perception of smell; hard palate development; positive regulation of transcription factor activity; Wnt receptor signaling pathway through beta-catenin; positive regulation of cGMP metabolic process