Mouse SPP1 Monoclonal Antibody | anti-SPP1 antibody

SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (HRP)

Cat. Num. AAA6181079

• Gene Names: SPP1; OPN; BNSP; BSPI; ETA-1
• Applications: Western Blot
• Purity: Purified
• Synonyms: SPP1; Monoclonal Antibody; SPP1 (Secreted Phosphoprotein 1; BNSP; BSPI; ETA-1; MGC110940; OPN) (HRP); Secreted Phosphoprotein 1; OPN; anti-SPP1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4B8
• Specificity: Recognizes SPP1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-SPP1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SPP1 (NP_000573.1, 21aa-129aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQTLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPAT
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SPP1 is approximately 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-SPP1 antibody

Antibodies; Osteopontin

NCBI and Uniprot Product Information

• NCBI GI #: 4759166
• NCBI GeneID: 6696
• NCBI Accession #: NP_000573.1
• NCBI GenBank Nucleotide #: NM_000582.2
• UniProt Accession #: P10451; Q15681; Q15682; Q15683; Q4W597; Q567T5; Q8NBK2; Q96IZ1; B2RDA1
• Molecular Weight: 35,423 Da
• NCBI Official Full Name: osteopontin isoform OPN-b
• NCBI Official Synonym Full Names: secreted phosphoprotein 1
• NCBI Official Symbol: SPP1
• NCBI Official Synonym Symbols: OPN; BNSP; BSPI; ETA-1
• NCBI Protein Information: osteopontin; uropontin; nephropontin; SPP1/CALPHA1 fusion; urinary stone protein; early T-lymphocyte activation 1; osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein; secreted phosphoprotein 1 (osteopontin, bone sialoprotein I,
• UniProt Protein Name: Osteopontin
• Protein Family: Sucrose-phosphatase
• UniProt Gene Name: SPP1
• UniProt Synonym Gene Names: BNSP; OPN; SPP-1
• UniProt Entry Name: OSTP_HUMAN

NCBI Description

The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

osteopontin: Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Belongs to the osteopontin family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 4q22.1

Cellular Component: extracellular space; cell projection; perinuclear region of cytoplasm; apical part of cell; extracellular region

Molecular Function: protein binding; extracellular matrix binding; cytokine activity

Biological Process: neutrophil chemotaxis; extracellular matrix organization and biogenesis; decidualization; osteoblast differentiation; extracellular matrix disassembly; response to vitamin D; biomineral formation; response to steroid hormone stimulus; negative regulation of collateral sprouting of intact axon in response to injury; positive regulation of bone resorption; inflammatory response; cell adhesion; embryo implantation