Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged HOXA11 is approximately 0.3ng/ml as a capture antibody.)

Mouse HOXA11 Monoclonal Antibody | anti-HOXA11 antibody

HOXA11 (Homeobox A11, HOX1, HOX1I) (HRP)

Gene Names
HOXA11; HOX1; HOX1I; RUSAT1
Applications
Western Blot
Purity
Purified
Synonyms
HOXA11; Monoclonal Antibody; HOXA11 (Homeobox A11; HOX1; HOX1I) (HRP); Homeobox A11; HOX1I; anti-HOXA11 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G7
Specificity
Recognizes HOXA11.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-HOXA11 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HOXA11 (NP_005514, 60aa-166aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQFFETAYGTPENLASSDYPGDKSAE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HOXA11 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HOXA11 is approximately 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-HOXA11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
homeobox protein Hox-A11
NCBI Official Synonym Full Names
homeobox A11
NCBI Official Symbol
HOXA11
NCBI Official Synonym Symbols
HOX1; HOX1I; RUSAT1
NCBI Protein Information
homeobox protein Hox-A11
UniProt Protein Name
Homeobox protein Hox-A11
Protein Family
UniProt Gene Name
HOXA11
UniProt Synonym Gene Names
HOX1I
UniProt Entry Name
HXA11_HUMAN

NCBI Description

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is involved in the regulation of uterine development and is required for female fertility. Mutations in this gene can cause radio-ulnar synostosis with amegakaryocytic thrombocytopenia. [provided by RefSeq, Jul 2008]

Uniprot Description

HOXA11: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Defects in HOXA11 are the cause of radioulnar synostosis with amegakaryocytic thrombocytopenia (RSAT). The syndrome consists of an unusual association of bone marrow failure and skeletal defects. Patients have the same skeletal defects, the proximal fusion of the radius and ulna, resulting in extremely limited pronation and supination of the forearm. Some patients have also symptomatic thrombocytopenia, with bruising and bleeding problems since birth, necessitating correction by bone marrow or umbilical-cord stem-cell transplantation. Belongs to the Abd-B homeobox family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 7p15.2

Cellular Component: transcription factor complex; protein complex; nucleus

Molecular Function: sequence-specific DNA binding

Biological Process: embryonic forelimb morphogenesis; developmental growth; anatomical structure morphogenesis; transcription, DNA-dependent; multicellular organismal development; positive regulation of transcription, DNA-dependent; male gonad development; uterus development; anterior/posterior pattern formation; positive regulation of chondrocyte differentiation; dorsal/ventral pattern formation; ureteric bud branching; single fertilization; induction of an organ; mesodermal cell fate specification; spermatogenesis; embryonic digit morphogenesis; skeletal development; metanephros development; proximal/distal pattern formation; embryonic limb morphogenesis

Disease: Radioulnar Synostosis With Amegakaryocytic Thrombocytopenia

Research Articles on HOXA11

Similar Products

Product Notes

The HOXA11 hoxa11 (Catalog #AAA6180947) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HOXA11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOXA11 hoxa11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXA11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.