Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FOXC2 monoclonal antibody (M04), clone 1A8 Western Blot analysis of FOXC2 expression in K-562 (Cat # L009V1).)

Mouse FOXC2 Monoclonal Antibody | anti-FOXC2 antibody

FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (HRP)

Gene Names
FOXC2; LD; MFH1; MFH-1; FKHL14
Applications
Western Blot
Purity
Purified
Synonyms
FOXC2; Monoclonal Antibody; FOXC2 (Forkhead Box C2 (MFH-1; Mesenchyme Forkhead 1); FKHL14; LD; MFH-1; MFH1) (HRP); Forkhead Box C2 (MFH-1; MFH1; anti-FOXC2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A8
Specificity
Recognizes FOXC2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-FOXC2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FOXC2 (NP_005242, 156aa-256aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FOXC2 monoclonal antibody (M04), clone 1A8 Western Blot analysis of FOXC2 expression in K-562 (Cat # L009V1).)

Western Blot (WB) (FOXC2 monoclonal antibody (M04), clone 1A8 Western Blot analysis of FOXC2 expression in K-562 (Cat # L009V1).)

Western Blot (WB)

(FOXC2 monoclonal antibody (M04), clone 1A8. Western Blot analysis of FOXC2 expression in PC-12.)

Western Blot (WB) (FOXC2 monoclonal antibody (M04), clone 1A8. Western Blot analysis of FOXC2 expression in PC-12.)

Testing Data

(Detection limit for recombinant GST tagged FOXC2 is 3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FOXC2 is 3 ng/ml as a capture antibody.)
Product Categories/Family for anti-FOXC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
forkhead box protein C2
NCBI Official Synonym Full Names
forkhead box C2
NCBI Official Symbol
FOXC2
NCBI Official Synonym Symbols
LD; MFH1; MFH-1; FKHL14
NCBI Protein Information
forkhead box protein C2
UniProt Protein Name
Forkhead box protein C2
Protein Family
UniProt Gene Name
FOXC2
UniProt Synonym Gene Names
FKHL14; MFH1; MFH-1 protein
UniProt Entry Name
FOXC2_HUMAN

NCBI Description

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. [provided by RefSeq, Jul 2008]

Uniprot Description

FOXC2: Transcriptional activator. Might be involved in the formation of special mesenchymal tissues. Defects in FOXC2 are the cause of lymphedema hereditary type 2 (LMPH2); also known as Meige lymphedema. Hereditary lymphedema is a chronic disabling condition which results in swelling of the extremities due to altered lymphatic flow. Patients with lymphedema suffer from recurrent local infections, and physical impairment. Defects in FOXC2 are a cause of lymphedema-yellow nails (LYYN). LYYN is characterized by yellow, dystrophic, thick and slowly growing nails, associated with lymphedema and respiratory involvement. Lymphedema occurs more often in the lower limbs. It can appear at birth or later in life. Onset generally follows the onset of ungual abnormalities. Defects in FOXC2 are a cause of lymphedema-distichiasis (LYD). LYD is characterized by primary limb lymphedema usually starting at puberty (but in some cases later or at birth) and associated with distichiasis (double rows of eyelashes, with extra eyelashes growing from the Meibomian gland orifices).

Protein type: Cell development/differentiation; Transcription factor; Apoptosis; DNA-binding

Chromosomal Location of Human Ortholog: 16q24.1

Cellular Component: nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; chromatin DNA binding; sequence-specific DNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; collagen fibril organization; neural crest cell development; heart development; positive regulation of transcription, DNA-dependent; response to hormone stimulus; cardiac muscle cell proliferation; negative regulation of transcription from RNA polymerase II promoter; ureteric bud development; lymphangiogenesis; ventricular cardiac muscle morphogenesis; mesoderm development; regulation of blood vessel size; somitogenesis; Notch signaling pathway; ossification; camera-type eye development; positive regulation of cell adhesion mediated by integrin; regulation of organ growth; embryonic viscerocranium morphogenesis; regulation of transcription from RNA polymerase II promoter; patterning of blood vessels; paraxial mesodermal cell fate commitment; insulin receptor signaling pathway; artery morphogenesis; embryonic heart tube development; positive regulation of transcription from RNA polymerase II promoter; blood vessel remodeling; vascular endothelial growth factor receptor signaling pathway; metanephros development

Disease: Lymphedema-distichiasis Syndrome

Research Articles on FOXC2

Similar Products

Product Notes

The FOXC2 foxc2 (Catalog #AAA6180362) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FOXC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOXC2 foxc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOXC2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.