Mouse DKK1 Monoclonal Antibody | anti-DKK1 antibody

DKK1 (Dickkopf Homolog 1 (Xenopus laevis), DKK-1, SK) (HRP)

Cat. Num. AAA6179518

• Gene Names: DKK1; SK; DKK-1
• Applications: Western Blot
• Purity: Purified
• Synonyms: DKK1; Monoclonal Antibody; DKK1 (Dickkopf Homolog 1 (Xenopus laevis); DKK-1; SK) (HRP); Dickkopf Homolog 1 (Xenopus laevis); SK; anti-DKK1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1F5
• Specificity: Recognizes DKK1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-DKK1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: DKK1 (NP_036374, 81aa-180aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(DKK1 monoclonal antibody (M02), clone 1F5 Western Blot analysis of DKK1 expression in HeLa (Cat # L013V1).)

Western Blot (WB)

(DKK1 monoclonal antibody (M02), clone 1F5. Western Blot analysis of DKK1 expression in Jurkat (Cat # L017V1).)

Product Categories/Family for anti-DKK1 antibody

Antibodies; Dickkopf Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 7110719
• NCBI GeneID: 22943
• NCBI Accession #: NP_036374
• NCBI GenBank Nucleotide #: NM_012242.3
• UniProt Accession #: O94907; B2RC19
• Molecular Weight: 27.8kDa (253aa) 28-40kDa (SDS-PAGE under reducing conditions)
• NCBI Official Full Name: dickkopf-related protein 1
• NCBI Official Synonym Full Names: dickkopf WNT signaling pathway inhibitor 1
• NCBI Official Symbol: DKK1
• NCBI Official Synonym Symbols: SK; DKK-1
• NCBI Protein Information: dickkopf-related protein 1
• UniProt Protein Name: Dickkopf-related protein 1
• Protein Family: Dickkopf-related protein
• UniProt Gene Name: DKK1
• UniProt Synonym Gene Names: Dickkopf-1; Dkk-1; hDkk-1
• UniProt Entry Name: DKK1_HUMAN

NCBI Description

This gene encodes a member of the dickkopf family of proteins. Members of this family are secreted proteins characterized by two cysteine-rich domains that mediate protein-protein interactions. The encoded protein binds to the LRP6 co-receptor and inhibits beta-catenin-dependent Wnt signaling. This gene plays a role in embryonic development and may be important in bone formation in adults. Elevated expression of this gene has been observed in numerous human cancers and this protein may promote proliferation, invasion and growth in cancer cell lines. [provided by RefSeq, Sep 2017]

Uniprot Description

DKK1: Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero- posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. Interacts with LRP6. Interacts (via the C-termianl Cys- rich domain) with LRP5 (via beta-propeller regions 3 and 4); the interaction, enhanced by MESD and or KREMEN, antagonizes Wnt- mediated signaling. Placenta. Belongs to the dickkopf family.

Protein type: Secreted; Secreted, signal peptide; Inhibitor

Chromosomal Location of Human Ortholog: 10q11.2

Cellular Component: extracellular space; early endosome membrane; extracellular region; plasma membrane

Molecular Function: protein binding; receptor antagonist activity; signal transducer activity; growth factor activity; low-density lipoprotein receptor binding

Biological Process: cellular morphogenesis during differentiation; negative regulation of skeletal muscle development; response to retinoic acid; negative regulation of Wnt receptor signaling pathway; regulation of receptor internalization; negative regulation of peptidyl-serine phosphorylation; negative regulation of transcription from RNA polymerase II promoter; negative regulation of BMP signaling pathway; negative regulation of mesodermal cell fate specification; mesoderm formation; hair follicle development; endoderm formation; forebrain development; regulation of endodermal cell fate specification; negative regulation of protein complex assembly; embryonic limb morphogenesis