Mouse ART3 Monoclonal Antibody | anti-ART3 antibody

ART3 (ADP-Ribosyltransferase 3, FLJ26404) (FITC)

Cat. Num. AAA6178200

• Gene Names: ART3; ARTC3
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified
• Synonyms: ART3; Monoclonal Antibody; ART3 (ADP-Ribosyltransferase 3; FLJ26404) (FITC); ADP-Ribosyltransferase 3; FLJ26404; anti-ART3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1D2
• Specificity: Recognizes ART3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ART3 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ART3 (NP_001170, 29aa-138aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAF
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ART3 expression in transfected 293T cell line by ART3 monoclonal antibody (M09), clone 1D2.Lane 1: ART3 transfected lysate (42.7 KDa).Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of ART3 transfected lysate using anti-ART3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ART3 MaxPab rabbit polyclonal antibody.)

Related Product Information for anti-ART3 antibody

ADP-ribosylation is a reversible posttranslational modification used to regulate protein function. ADP-ribosyltransferases, such as ART3, transfer ADP-ribose from NAD+ to the target protein, and ADP-ribosylhydrolases (see PARG; MIM 603501) reverse the reaction (Glowacki et al., 2002 [PubMed 12070318]). [supplied by OMIM]

Product Categories/Family for anti-ART3 antibody

Antibodies; Enzymes; Ribosyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 21361167
• NCBI GeneID: 419
• NCBI Accession #: NP_001170
• NCBI GenBank Nucleotide #: NM_001179
• UniProt Accession #: Q13508
• Molecular Weight: 40kDa
• NCBI Official Full Name: ecto-ADP-ribosyltransferase 3 isoform b
• NCBI Official Synonym Full Names: ADP-ribosyltransferase 3
• NCBI Official Symbol: ART3
• NCBI Official Synonym Symbols: ARTC3
• NCBI Protein Information: ecto-ADP-ribosyltransferase 3
• UniProt Protein Name: Ecto-ADP-ribosyltransferase 3
• Protein Family: Ecto-ADP-ribosyltransferase
• UniProt Gene Name: ART3
• UniProt Synonym Gene Names: TMART; ARTC3
• UniProt Entry Name: NAR3_HUMAN

NCBI Description

This gene encodes an arginine-specific ADP-ribosyltransferase. The encoded protein catalyzes a reversible reaction which modifies proteins by the addition or removal of ADP-ribose to an arginine residue to regulate the function of the modified protein. An ADP-ribosyltransferase pseudogene is located on chromosome 11. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

ART3: an arginine-specific ADP-ribosyltransferase. The encoded protein catalyzes a reversible reaction which modifies proteins by the addition or removal of ADP-ribose to an arginine residue to regulate the function of the modified protein. An ADP-ribosyltransferase pseudogene is located on chromosome 11. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Protein type: Membrane protein, integral; Membrane protein, GPI anchor; EC 2.4.2.31; Transferase

Chromosomal Location of Human Ortholog: 4q21.1|4p15.1-p14

Cellular Component: integral to plasma membrane

Molecular Function: NAD(P)+-protein-arginine ADP-ribosyltransferase activity; NAD+ ADP-ribosyltransferase activity

Biological Process: protein amino acid ADP-ribosylation