Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse INPPL1 Monoclonal Antibody | anti-INPPL1 antibody

INPPL1 (Inositol Polyphosphate Phosphatase-like 1, SHIP2) (FITC)

Gene Names
INPPL1; OPSMD; SHIP2
Applications
Western Blot
Purity
Purified
Synonyms
INPPL1; Monoclonal Antibody; INPPL1 (Inositol Polyphosphate Phosphatase-like 1; SHIP2) (FITC); Inositol Polyphosphate Phosphatase-like 1; SHIP2; anti-INPPL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
10G6
Specificity
Recognizes INPPL1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1258
Applicable Applications for anti-INPPL1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
INPPL1 (NP_001558, 1159aa-1258aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-INPPL1 antibody
The protein encoded by this gene is an SH2-containing 5'-inositol phosphatase that is involved in the regulation of insulin function. The encoded protein also plays a role in the regulation of epidermal growth factor receptor turnover and actin remodelling. Additionally, this gene supports metastatic growth in breast cancer and is a valuable biomarker for breast cancer. [provided by RefSeq]
Product Categories/Family for anti-INPPL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
NCBI Official Synonym Full Names
inositol polyphosphate phosphatase like 1
NCBI Official Symbol
INPPL1
NCBI Official Synonym Symbols
OPSMD; SHIP2
NCBI Protein Information
phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
UniProt Protein Name
Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
UniProt Gene Name
INPPL1
UniProt Synonym Gene Names
SHIP2; INPPL-1; SH2 domain-containing inositol phosphatase 2; SHIP-2
UniProt Entry Name
SHIP2_HUMAN

NCBI Description

The protein encoded by this gene is an SH2-containing 5'-inositol phosphatase that is involved in the regulation of insulin function. The encoded protein also plays a role in the regulation of epidermal growth factor receptor turnover and actin remodelling. Additionally, this gene supports metastatic growth in breast cancer and is a valuable biomarker for breast cancer. [provided by RefSeq, Jan 2009]

Uniprot Description

SHIP-2: an SH2-containing inositol phosphatase. Recruited to activated receptor complexes including insulin R, PDGFR and Fc-gamma-R.

Protein type: Carbohydrate Metabolism - inositol phosphate; Phosphatase, lipid; Motility/polarity/chemotaxis; EC 3.1.3.86

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: Golgi apparatus; cytoskeleton; lamellipodium; cytoplasm; plasma membrane; cytosol; filopodium

Molecular Function: protein binding; hydrolase activity; SH2 domain binding; actin binding; SH3 domain binding

Biological Process: inositol phosphate metabolic process; immune system process; actin filament organization; glucose metabolic process; endocytosis; response to insulin stimulus; post-embryonic development; negative regulation of cell proliferation; phospholipid metabolic process; phosphatidylinositol biosynthetic process; phosphoinositide dephosphorylation; cell adhesion; endochondral ossification

Disease: Opsismodysplasia

Research Articles on INPPL1

Similar Products

Product Notes

The INPPL1 inppl1 (Catalog #AAA6177368) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's INPPL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the INPPL1 inppl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "INPPL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.