Mouse SMG1 Monoclonal Antibody | anti-SMG1 antibody

SMG1 (SMG1 Homolog, Phosphatidylinositol 3-Kinase-Related Kinase (C. elegans), 61E3.4, ATX, KIAA0421, LIP) (FITC)

Cat. Num. AAA6175840

• Gene Names: SLK; LOSK; STK2; se20-9; bA16H23.1
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: SMG1; Monoclonal Antibody; SMG1 (SMG1 Homolog; Phosphatidylinositol 3-Kinase-Related Kinase (C. elegans); 61E3.4; ATX; KIAA0421; LIP) (FITC); SMG1 Homolog; LIP; anti-SMG1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C12
• Specificity: Recognizes SMG1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-SMG1 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SMG1 (NP_055535, 2922aa-3031aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SMG1 monoclonal antibody (M03), clone 1C12 Western Blot analysis of SMG1 expression in Hela S3 NE (Cat # L013V3).)

Testing Data

(Detection limit for recombinant GST tagged SMG1 is approximately 0.1ng/ml as a capture antibody.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SMG1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SMG1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 1.5 ug/ml])

Related Product Information for anti-SMG1 antibody

This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternative spliced transcript variants have been described, but their full-length natures have not been determined. [provided by RefSeq]

Product Categories/Family for anti-SMG1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 41281453
• NCBI GeneID: 9748
• NCBI Accession #: NP_055535
• NCBI GenBank Nucleotide #: NM_014720
• UniProt Accession #: Q9H2G2; O00211; Q6P1Z4; Q86WU7; Q86WW1; Q92603; Q9NQL0; Q9NQL1; D3DRA0; D3DRA1
• Molecular Weight: 138,996 Da
• NCBI Official Full Name: STE20-like serine/threonine-protein kinase isoform 1
• NCBI Official Synonym Full Names: STE20-like kinase
• NCBI Official Symbol: SLK
• NCBI Official Synonym Symbols: LOSK; STK2; se20-9; bA16H23.1
• NCBI Protein Information: STE20-like serine/threonine-protein kinase; CTCL tumor antigen se20-9; Long Ste20-like Kinase; SNF1 (sucrose nonfermenting, yeast, homolog)-like kinase, SNF1 sucrose nonfermenting like kinase; STE20-related kinase; STE20-related serine/threonine-protein k
• UniProt Protein Name: STE20-like serine/threonine-protein kinase
• Protein Family: Probable serine/threonine-protein kinase
• UniProt Gene Name: SLK
• UniProt Synonym Gene Names: KIAA0204; STK2; STE20-like kinase; hSLK
• UniProt Entry Name: SLK_HUMAN

Uniprot Description

SLK: a microtubule-associated protein kinase required for progression through G2. Co-localizes with the mitotic spindle in cells undergoing mitosis. Regulates actin reorganization during cell adhesion and spreading via a Rac1-mediated pathway. Signals via ASK1 and p38 to promote apoptosis. Activated in response to anoxia and ischemia-reperfusion injury in cell culture. It inhibits the protective aspects of the endoplasmic reticulum stress response, thus contributing to its proapoptotic effect. Two alternatively-spliced isoforms have been described.

Protein type: Protein kinase, STE; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; STE group; STE20 family; SLK subfamily

Chromosomal Location of Human Ortholog: 10q24.33

Cellular Component: cytoplasm

Molecular Function: protein serine/threonine kinase activity; identical protein binding; protein homodimerization activity; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: apoptosis; protein amino acid autophosphorylation