Mouse LRP8 Monoclonal Antibody | anti-LRP8 antibody

LRP8 (Low Density Lipoprotein Receptor-Related Protein 8, ApoLipoprotein e Receptor, APOER2, HSZ75190, MCI1) (Biotin)

Cat. Num. AAA6173496

• Gene Names: LRP8; MCI1; LRP-8; APOER2; HSZ75190
• Applications: Western Blot
• Purity: Purified
• Synonyms: LRP8; Monoclonal Antibody; LRP8 (Low Density Lipoprotein Receptor-Related Protein 8; ApoLipoprotein e Receptor; APOER2; HSZ75190; MCI1) (Biotin); Low Density Lipoprotein Receptor-Related Protein 8; MCI1; anti-LRP8 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A1
• Specificity: Recognizes LRP8.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 963

• Applicable Applications for anti-LRP8 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: LRP8 (NP_004622, 83aa-170aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged LRP8 is 0.3 ng/ml as a capture antibody.)

Related Product Information for anti-LRP8 antibody

This gene encodes an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL). The apolipoprotein E receptor is involved in cellular recognition and internalization of these lipoproteins. Alternative splicing generates multiple transcript variants encoding distinct isoforms for this gene. [provided by RefSeq]

Product Categories/Family for anti-LRP8 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 61744471
• NCBI GeneID: 7804
• NCBI Accession #: NP_004622
• NCBI GenBank Nucleotide #: NP_004622.2
• UniProt Accession #: Q14114
• NCBI Official Full Name: low-density lipoprotein receptor-related protein 8 isoform 1
• NCBI Official Synonym Full Names: LDL receptor related protein 8
• NCBI Official Symbol: LRP8
• NCBI Official Synonym Symbols: MCI1; LRP-8; APOER2; HSZ75190
• NCBI Protein Information: low-density lipoprotein receptor-related protein 8
• UniProt Protein Name: Low-density lipoprotein receptor-related protein 8
• Protein Family: Low-density lipoprotein receptor-related protein
• UniProt Gene Name: LRP8
• UniProt Synonym Gene Names: APOER2; LRP-8
• UniProt Entry Name: LRP8_HUMAN

NCBI Description

This gene encodes a member of the low density lipoprotein receptor (LDLR) family. Low density lipoprotein receptors are cell surface proteins that play roles in both signal transduction and receptor-mediated endocytosis of specific ligands for lysosomal degradation. The encoded protein plays a critical role in the migration of neurons during development by mediating Reelin signaling, and also functions as a receptor for the cholesterol transport protein apolipoprotein E. Expression of this gene may be a marker for major depressive disorder. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jun 2011]

Uniprot Description

LRP8: Cell surface receptor for Reelin (RELN) and apolipoprotein E (apoE)-containing ligands. LRP8 participates in transmitting the extracellular Reelin signal to intracellular signaling processes, by binding to DAB1 on its cytoplasmic tail. Reelin acts via both the VLDL receptor (VLDLR) and LRP8 to regulate DAB1 tyrosine phosphorylation and microtubule function in neurons. LRP8 has higher affinity for Reelin than VLDLR. LRP8 is thus a key component of the Reelin pathway which governs neuronal layering of the forebrain during embryonic brain development. Binds the endoplasmic reticulum resident receptor-associated protein (RAP). Binds dimers of beta 2-glycoprotein I and may be involved in the suppression of platelet aggregation in the vasculature. Highly expressed in the initial segment of the epididymis, where it affects the functional expression of clusterin and phospholipid hydroperoxide glutathione peroxidase (PHGPx), two proteins required for sperm maturation. May also function as an endocytic receptor. Defects in LRP8 are a cause of myocardial infarction type 1 (MCI1). A condition defined by the irreversible necrosis of heart muscle secondary to prolonged ischemia. Belongs to the LDLR family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p34

Cellular Component: microtubule associated complex; membrane; cell soma; axon; dendrite; postsynaptic density; extracellular region; integral to membrane; plasma membrane; caveola; receptor complex

Molecular Function: very-low-density lipoprotein receptor activity; protein binding; transmembrane receptor activity; kinesin binding; apolipoprotein binding; calcium ion binding; high-density lipoprotein binding

Biological Process: regulation of synaptic transmission; response to drug; receptor-mediated endocytosis; phototransduction, visible light; cytokine and chemokine mediated signaling pathway; activation of CREB transcription factor; endocytosis; negative regulation of transcription from RNA polymerase II promoter; signal transduction; proteolysis; ammon gyrus development; positive regulation of peptidyl-tyrosine phosphorylation; lipid metabolic process; retinoid metabolic process; blood coagulation; layer formation in the cerebral cortex

Disease: Myocardial Infarction, Susceptibility To