Western Blot (WB)
(Western Blot analysis of CMTM4 expression in transfected 293T cell line by CMTM4 monoclonal antibody (M02), clone 1B9.Lane 1: CMTM4 transfected lysate (25.8 KDa).Lane 2: Non-transfected lysate.)
Mouse CMTM4 Monoclonal Antibody | anti-CMTM4 antibody
CMTM4 (CKLF-like MARVEL Transmembrane Domain Containing 4, CKLFSF4) (Biotin)
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
CMTM4; Monoclonal Antibody; CMTM4 (CKLF-like MARVEL Transmembrane Domain Containing 4; CKLFSF4) (Biotin); CKLF-like MARVEL Transmembrane Domain Containing 4; CKLFSF4; anti-CMTM4 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B9
Specificity
Recognizes CMTM4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
234
Applicable Applications for anti-CMTM4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CMTM4 (NP_848933, 173aa-234aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQLA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of CMTM4 expression in transfected 293T cell line by CMTM4 monoclonal antibody (M02), clone 1B9.Lane 1: CMTM4 transfected lysate (25.8 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of CMTM4 expression in transfected 293T cell line by CMTM4 monoclonal antibody (M02), clone 1B9.Lane 1: CMTM4 transfected lysate (25.8 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-CMTM4 antibody
This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]
Product Categories/Family for anti-CMTM4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
CKLF-like MARVEL transmembrane domain-containing protein 4 isoform 1
UniProt Protein Name
CKLF-like MARVEL transmembrane domain-containing protein 4
Protein Family
UniProt Gene Name
CMTM4
UniProt Synonym Gene Names
CKLFSF4
UniProt Entry Name
CKLF4_HUMAN
Similar Products
Product Notes
The CMTM4 cmtm4 (Catalog #AAA6173079) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CMTM4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CMTM4 cmtm4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CMTM4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
