Mouse MACF1 Monoclonal Antibody | anti-MACF1 antibody

MACF1 (Microtubule-Actin Crosslinking Factor 1, ABP620, ACF7, FLJ45612, FLJ46776, KIAA0465, KIAA1251, MACF, OFC4) (Biotin)

Cat. Num. AAA6171802

• Gene Names: MACF1; ACF7; LIS9; MACF; OFC4; ABP620
• Applications: ELISA
• Purity: Purified
• Synonyms: MACF1; Monoclonal Antibody; MACF1 (Microtubule-Actin Crosslinking Factor 1; ABP620; ACF7; FLJ45612; FLJ46776; KIAA0465; KIAA1251; MACF; OFC4) (Biotin); Microtubule-Actin Crosslinking Factor 1; OFC4; anti-MACF1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6G7
• Specificity: Recognizes MACF1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 305

• Applicable Applications for anti-MACF1 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MACF1 (AAH07330, 1aa-95aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MACF1 is approximately 1ng/ml as a capture antibody.)

Related Product Information for anti-MACF1 antibody

The protein encoded by this gene belongs to the plakin family of cytoskeletal linker proteins. This protein family forms bridges between different cytoskeletal elements through specialized modular domains. The encoded protein is one of the largest size proteins identified in human cytoskeletal proteins. It has functional actin and microtubule binding domains, and it appears to stabilize actin at sites where microtubules and microfilaments meet. It may function in microtubule dynamics to facilitate actin-microtubule interactions at the cell periphery and to couple the microtubule network to cellular junctions. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]

Product Categories/Family for anti-MACF1 antibody

Antibodies; Microtubule-associated Proteins

References

1. Laminin-based cell adhesion anchors microtubule plus ends to the epithelial cell basal cortex through LL5{alpha}/{beta}.Hotta A, Kawakatsu T, Nakatani T, Sato T, Matsui C, Sukezane T, Akagi T, Hamaji T, Grigoriev I, Akhmanova A, Takai Y, Mimori-Kiyosue Y.J Cell Biol. 2010 May 31;189(5):901-17.

NCBI and Uniprot Product Information

• NCBI GI #: 39644766
• NCBI GeneID: 23499
• NCBI Official Full Name: MACF1 protein, partial
• NCBI Official Synonym Full Names: microtubule actin crosslinking factor 1
• NCBI Official Symbol: MACF1
• NCBI Official Synonym Symbols: ACF7; LIS9; MACF; OFC4; ABP620
• NCBI Protein Information: microtubule-actin cross-linking factor 1
• Protein Family: Microtubule-actin cross-linking factor

NCBI Description

This gene encodes a large protein containing numerous spectrin and leucine-rich repeat (LRR) domains. The encoded protein is a member of a family of proteins that form bridges between different cytoskeletal elements. This protein facilitates actin-microtubule interactions at the cell periphery and couples the microtubule network to cellular junctions. Alternative splicing results in multiple transcript variants, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, May 2013]