Mouse ROR2 Monoclonal Antibody | anti-ROR2 antibody

ROR2 (Receptor Tyrosine Kinase-like orphan Receptor 2, BDB, BDB1, MGC163394, NTRKR2) (Biotin)

Cat. Num. AAA6171181

• Gene Names: ROR2; BDB; BDB1; NTRKR2
• Applications: ELISA
• Purity: Purified
• Synonyms: ROR2; Monoclonal Antibody; ROR2 (Receptor Tyrosine Kinase-like orphan Receptor 2; BDB; BDB1; MGC163394; NTRKR2) (Biotin); Receptor Tyrosine Kinase-like orphan Receptor 2; NTRKR2; anti-ROR2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4B7
• Specificity: Recognizes ROR2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-ROR2 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ROR2 (NP_004551, 34aa-143aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKT
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ROR2 is approximately 3ng/ml as a capture antibody.)

Related Product Information for anti-ROR2 antibody

The protein encoded by this gene is a receptor protein tyrosine kinase and type I transmembrane protein that belongs to the ROR subfamily of cell surface receptors. The protein may be involved in the early formation of the chondrocytes and may be required for cartilage and growth plate development. Mutations in this gene can cause brachydactyly type B, a skeletal disorder characterized by hypoplasia/aplasia of distal phalanges and nails. In addition, mutations in this gene can cause the autosomal recessive form of Robinow syndrome, which is characterized by skeletal dysplasia with generalized limb bone shortening, segmental defects of the spine, brachydactyly, and a dysmorphic facial appearance. [provided by RefSeq]

Product Categories/Family for anti-ROR2 antibody

Antibodies; Tyrosine Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 19743898
• NCBI GeneID: 4920
• NCBI Accession #: NP_004551
• NCBI GenBank Nucleotide #: NM_004560
• UniProt Accession #: Q01974; Q59GF5; Q5SPI5; Q9HAY7; Q9HB61
• Molecular Weight: 104,757 Da
• NCBI Official Full Name: tyrosine-protein kinase transmembrane receptor ROR2
• NCBI Official Synonym Full Names: receptor tyrosine kinase-like orphan receptor 2
• NCBI Official Symbol: ROR2
• NCBI Official Synonym Symbols: BDB; BDB1; NTRKR2
• NCBI Protein Information: tyrosine-protein kinase transmembrane receptor ROR2; neurotrophic tyrosine kinase receptor-related 2
• UniProt Protein Name: Tyrosine-protein kinase transmembrane receptor ROR2
• UniProt Gene Name: ROR2
• UniProt Synonym Gene Names: NTRKR2
• UniProt Entry Name: ROR2_HUMAN

Uniprot Description

ROR2: a receptor tyrosine kinase of the ROR family. May be involved in the early formation of the chondrocytes and may be required for cartilage and growth plate development. Mutations can cause brachydactyly type B, a skeletal disorder characterized by hypoplasia/aplasia of distal phalanges and nails. In addition, mutations in this gene can cause the autosomal recessive form of Robinow syndrome, which is characterized by skeletal dysplasia with generalized limb bone shortening, segmental defects of the spine, brachydactyly, and a dysmorphic facial appearance.

Protein type: Protein kinase, TK; Membrane protein, integral; Kinase, protein; Protein kinase, tyrosine (receptor); EC 2.7.10.1; TK group; Ror family

Chromosomal Location of Human Ortholog: 9q22

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: Wnt-protein binding; protein binding; frizzled binding; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: somitogenesis; inner ear morphogenesis; peptidyl-tyrosine phosphorylation; Wnt receptor signaling pathway, planar cell polarity pathway; multicellular organismal development; positive regulation of transcription, DNA-dependent; signal transduction; negative regulation of cell proliferation; Wnt receptor signaling pathway, calcium modulating pathway; JNK cascade; cell differentiation; transmembrane receptor protein tyrosine kinase signaling pathway; cartilage condensation; embryonic genitalia morphogenesis; positive regulation of cell migration

Disease: Robinow Syndrome, Autosomal Recessive; Brachydactyly, Type B1