Mouse CDK4 Monoclonal Antibody | anti-CDK4 antibody

CDK4 (Cyclin-Dependent Kinase 4, CMM3, MGC14458, PSK-J3) (Biotin)

Cat. Num. AAA6170364

• Gene Names: CDK4; CMM3; PSK-J3
• Applications: Western Blot
• Purity: Purified
• Synonyms: CDK4; Monoclonal Antibody; CDK4 (Cyclin-Dependent Kinase 4; CMM3; MGC14458; PSK-J3) (Biotin); Cyclin-Dependent Kinase 4; PSK-J3; anti-CDK4 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 8C3
• Specificity: Recognizes CDK4.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 303

• Applicable Applications for anti-CDK4 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CDK4 (AAH03644, 211aa-303aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CDK4 monoclonal antibody (M07), clone 8C3 Western Blot analysis of CDK4 expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged CDK4 is approximately 0.3ng/ml as a capture antibody.)

Western Blot (WB)

(CDK4 monoclonal antibody (M07), clone 8C3. Western Blot analysis of CDK4 expression in NIH/3T3.)

Western Blot (WB)

(CDK4 monoclonal antibody (M07), clone 8C3. Western Blot analysis of CDK4 expression in Raw 264.7.)

Related Product Information for anti-CDK4 antibody

The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported. [provided by RefSeq]

Product Categories/Family for anti-CDK4 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 13177739
• NCBI GeneID: 1019
• NCBI Official Full Name: Cyclin-dependent kinase 4
• NCBI Official Synonym Full Names: cyclin dependent kinase 4
• NCBI Official Symbol: CDK4
• NCBI Official Synonym Symbols: CMM3; PSK-J3
• NCBI Protein Information: cyclin-dependent kinase 4
• Protein Family: Cyclin-dependent kinase

NCBI Description

The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported. [provided by RefSeq, Jul 2008]