<
Western Blot (WB)
(SRGAP1 monoclonal antibody (M07), clone 5D10. Western Blot analysis of SRGAP1 expression in NIH/3T3.)
Mouse SRGAP1 Monoclonal Antibody | anti-SRGAP1 antibody
SRGAP1 (SLIT-ROBO Rho GTPase Activating Protein 1, ARHGAP13, FLJ22166, KIAA1304) (APC)
Gene Names
SRGAP1; NMTC2; ARHGAP13
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
SRGAP1; Monoclonal Antibody; SRGAP1 (SLIT-ROBO Rho GTPase Activating Protein 1; ARHGAP13; FLJ22166; KIAA1304) (APC); SLIT-ROBO Rho GTPase Activating Protein 1; KIAA1304; anti-SRGAP1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5D10
Specificity
Recognizes SRGAP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1085
Applicable Applications for anti-SRGAP1 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SRGAP1 (NP_065813, 952aa-1050aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PLDPETIAQDIEETMNTALNELRELERQSTAKHAPDVVLDTLEQVKNSPTPATSTESLSPLHNVALRSSEPQIRRSTSSSSDTMSTFKPMVAPRMGVQL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(SRGAP1 monoclonal antibody (M07), clone 5D10. Western Blot analysis of SRGAP1 expression in NIH/3T3.)
Western Blot (WB)
(SRGAP1 monoclonal antibody (M07), clone 5D10. Western Blot analysis of SRGAP1 expression in NIH/3T3.)
Western Blot (WB)
(SRGAP1 monoclonal antibody (M07), clone 5D10. Western Blot analysis of SRGAP1 expression in IMR-32.)
Western Blot (WB)
(SRGAP1 monoclonal antibody (M07), clone 5D10. Western Blot analysis of SRGAP1 expression in IMR-32.)
Testing Data
(Detection limit for recombinant GST tagged SRGAP1 is 0.03 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SRGAP1 is 0.03 ng/ml as a capture antibody.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SRGAP1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SRGAP1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SRGAP1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SRGAP1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-SRGAP1 antibody
Mouse monoclonal antibody raised against a partial recombinant SRGAP1.
Product Categories/Family for anti-SRGAP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
SLIT-ROBO Rho GTPase-activating protein 1 isoform 1
NCBI Official Synonym Full Names
SLIT-ROBO Rho GTPase activating protein 1
NCBI Official Symbol
SRGAP1
NCBI Official Synonym Symbols
NMTC2; ARHGAP13
NCBI Protein Information
SLIT-ROBO Rho GTPase-activating protein 1
UniProt Protein Name
SLIT-ROBO Rho GTPase-activating protein 1
Protein Family
UniProt Gene Name
SRGAP1
UniProt Synonym Gene Names
ARHGAP13; KIAA1304
UniProt Entry Name
SRGP1_HUMAN
NCBI Description
The protein encoded by this gene is a GTPase activator, working with the GTPase CDC42 to negatively regulate neuronal migration. The encoded protein interacts with the transmembrane receptor ROBO1 to inactivate CDC42. [provided by RefSeq, Sep 2016]
Research Articles on SRGAP1
Similar Products
Product Notes
The SRGAP1 srgap1 (Catalog #AAA6169433) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SRGAP1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SRGAP1 srgap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SRGAP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
