Testing Data
(Detection limit for recombinant GST tagged FXN is 0.03 ng/ml as a capture antibody.)
Mouse FXN Monoclonal Antibody | anti-FXN antibody
FXN (frataxin, CyaY, FA, FARR, FRDA, MGC57199, X25) (APC)
Gene Names
FXN; FA; X25; CyaY; FARR; FRDA
Applications
Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
FXN; Monoclonal Antibody; FXN (frataxin; CyaY; FA; FARR; FRDA; MGC57199; X25) (APC); frataxin; X25; anti-FXN antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D9
Specificity
Recognizes FXN.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
210
Applicable Applications for anti-FXN antibody
Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FXN (AAH48097.1, 91aa-200aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged FXN is 0.03 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged FXN is 0.03 ng/ml as a capture antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of FXN transfected lysate using anti-FXN monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with FXN MaxPab rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of FXN transfected lysate using anti-FXN monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with FXN MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-FXN antibody
This nuclear gene encodes a mitochondrial protein which belongs to FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq]
Product Categories/Family for anti-FXN antibody
NCBI and Uniprot Product Information
NCBI Description
This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]
Research Articles on FXN
Similar Products
Product Notes
The FXN (Catalog #AAA6168570) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FXN can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FXN for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FXN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
