Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse DNER Monoclonal Antibody | anti-DNER antibody

DNER (delta/notch-like EGF Repeat Containing, UNQ26, bet) (AP)

Gene Names
DNER; bet; UNQ26
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
DNER; Monoclonal Antibody; DNER (delta/notch-like EGF Repeat Containing; UNQ26; bet) (AP); delta/notch-like EGF Repeat Containing; bet; anti-DNER antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
2F3
Specificity
Recognizes DNER.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
737
Applicable Applications for anti-DNER antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DNER (NP_620711, 368aa-476aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPEGYFGSACEEKVDLCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFCALSP
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DNER antibody
Mouse monoclonal antibody raised against a partial recombinant DNER.
Product Categories/Family for anti-DNER antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
delta and Notch-like epidermal growth factor-related receptor
NCBI Official Synonym Full Names
delta/notch like EGF repeat containing
NCBI Official Symbol
DNER
NCBI Official Synonym Symbols
bet; UNQ26
NCBI Protein Information
delta and Notch-like epidermal growth factor-related receptor
UniProt Protein Name
Delta and Notch-like epidermal growth factor-related receptor
UniProt Gene Name
DNER
UniProt Synonym Gene Names
BET
UniProt Entry Name
DNER_HUMAN

Uniprot Description

DNER: Activator of the NOTCH1 pathway. May mediate neuron-glia interaction during astrocytogenesis.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q36.3

Cellular Component: cell soma; early endosome; dendrite; plasma membrane; integral to membrane

Molecular Function: clathrin binding; protein binding; transmembrane receptor activity; calcium ion binding; Notch binding

Biological Process: Notch signaling pathway; glial cell differentiation; central nervous system development; synaptogenesis; neuron migration; skeletal muscle fiber development; Notch receptor processing; endocytosis

Research Articles on DNER

Similar Products

Product Notes

The DNER dner (Catalog #AAA6165041) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DNER can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DNER dner for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DNER, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.