Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SLC11A2 is approximately 0.03ng/ml as a capture antibody.)

Mouse SLC11A2 Monoclonal Antibody | anti-SLC11A2 antibody

SLC11A2 (Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 2, DCT1, DMT1, FLJ37416, NRAMP2) (AP)

Gene Names
SLC11A2; DCT1; DMT1; AHMIO1; NRAMP2
Applications
Western Blot
Purity
Purified
Synonyms
SLC11A2; Monoclonal Antibody; SLC11A2 (Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters); Member 2; DCT1; DMT1; FLJ37416; NRAMP2) (AP); Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters); NRAMP2; anti-SLC11A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F7
Specificity
Recognizes SLC11A2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SLC11A2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SLC11A2 (NP_000608, 1aa-65aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SLC11A2 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC11A2 is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-SLC11A2 antibody
The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]). [supplied by OMIM].
Product Categories/Family for anti-SLC11A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
natural resistance-associated macrophage protein 2 isoform 3
NCBI Official Synonym Full Names
solute carrier family 11 member 2
NCBI Official Symbol
SLC11A2
NCBI Official Synonym Symbols
DCT1; DMT1; AHMIO1; NRAMP2
NCBI Protein Information
natural resistance-associated macrophage protein 2
UniProt Protein Name
Natural resistance-associated macrophage protein 2
UniProt Gene Name
SLC11A2
UniProt Synonym Gene Names
DCT1; DMT1; NRAMP2; NRAMP 2; DMT-1
UniProt Entry Name
NRAM2_HUMAN

NCBI Description

This gene encodes a member of the solute carrier family 11 protein family. The product of this gene transports divalent metals and is involved in iron absorption. Mutations in this gene are associated with hypochromic microcytic anemia with iron overload. A related solute carrier family 11 protein gene is located on chromosome 2. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Apr 2010]

Uniprot Description

SLC11A2: Important in metal transport, in particular iron. Can also transport manganese, cobalt, cadmium, nickel, vanadium and lead. Involved in apical iron uptake into duodenal enterocytes. Involved in iron transport from acidified endosomes into the cytoplasm of erythroid precursor cells. May play an important role in hepatic iron accumulation and tissue iron distribution. Defects in SLC11A2 are a cause of hypochromic microcytic anemia (HCMA). The disease is characterized by an abnormal hemoglobin content in the erythrocytes which are reduced in size. It may be hereditary or acquired. Mutations in SLC11A2 are associated with progressive liver iron overload and normal to moderately elevated serum ferritin levels. Belongs to the NRAMP family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, SLC family; Membrane protein, multi-pass; Membrane protein, integral; Transporter

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: cell surface; integral to plasma membrane; late endosome membrane; lysosomal membrane; lysosome; early endosome; trans-Golgi network; mitochondrial outer membrane; recycling endosome; membrane; perinuclear region of cytoplasm; apical part of cell; cytoplasm; apical plasma membrane; late endosome; plasma membrane; vacuole; cytoplasmic vesicle; nucleus; brush border

Molecular Function: cadmium ion transmembrane transporter activity; nickel ion transmembrane transporter activity; inorganic cation transmembrane transporter activity; zinc ion binding; hydrogen ion transmembrane transporter activity; manganese ion transmembrane transporter activity; cadmium ion binding; vanadium ion transmembrane transporter activity; nickel ion binding; copper ion transmembrane transporter activity; protein binding; copper ion binding; manganese ion binding; iron ion binding; calcium ion transmembrane transporter activity; zinc ion transmembrane transporter activity; cobalt ion transmembrane transporter activity; lead ion transmembrane transporter activity; ferrous iron transmembrane transporter activity; cobalt ion binding; solute:hydrogen symporter activity

Biological Process: caspase activation; lead ion transport; erythrocyte development; cellular copper ion homeostasis; cellular iron ion homeostasis; dendrite morphogenesis; manganese ion transport; copper ion transport; response to manganese ion; nickel ion transport; response to cadmium ion; learning and/or memory; vanadium ion transport; detection of oxygen; ferrous iron transport; response to lead ion; response to hypoxia; transmembrane transport; response to iron ion; cobalt ion transport; heme biosynthetic process

Disease: Anemia, Hypochromic Microcytic, With Iron Overload 1

Research Articles on SLC11A2

Similar Products

Product Notes

The SLC11A2 slc11a2 (Catalog #AAA6164207) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC11A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC11A2 slc11a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC11A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.