Mouse anti-Human USP10 Monoclonal Antibody | anti-USP10 antibody

USP10 (Ubiquitin-specific-processing Protease 10, Ubiquitin Carboxyl-terminal Hydrolase 10, Deubiquitinating Enzyme 10, Ubiquitin Thioesterase 10, KIAA0190, UBPO) (PE)

Cat. Num. AAA6161000

• Gene Names: USP10; UBPO
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: USP10; Monoclonal Antibody; USP10 (Ubiquitin-specific-processing Protease 10; Ubiquitin Carboxyl-terminal Hydrolase 10; Deubiquitinating Enzyme 10; Ubiquitin Thioesterase 10; KIAA0190; UBPO) (PE); EC=3.4.19.12; anti-USP10 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B8
• Specificity: Recognizes human USP10.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 3328

• Applicable Applications for anti-USP10 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa699-797 from human USP10 (NP_005144) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KLIKNIEYPVDLEISKELLSPGVKNKNFKCHRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPTAERTAYLLYYRRVDL
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to USP10 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged USP10 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-USP10 antibody

Antibodies; Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 1677529910
• NCBI GeneID: 9100
• NCBI Accession #: NM_005153.3
• NCBI GenBank Nucleotide #: NM_005153
• UniProt Accession #: Q14694
• NCBI Official Full Name: Homo sapiens ubiquitin specific peptidase 10 (USP10), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: ubiquitin specific peptidase 10
• NCBI Official Symbol: USP10
• NCBI Official Synonym Symbols: UBPO
• NCBI Protein Information: ubiquitin carboxyl-terminal hydrolase 10
• UniProt Protein Name: Ubiquitin carboxyl-terminal hydrolase 10
• UniProt Gene Name: USP10
• UniProt Synonym Gene Names: KIAA0190
• UniProt Entry Name: UBP10_HUMAN

NCBI Description

Ubiquitin is a highly conserved protein that is covalently linked to other proteins to regulate their function and degradation. This gene encodes a member of the ubiquitin-specific protease family of cysteine proteases. The enzyme specifically cleaves ubiquitin from ubiquitin-conjugated protein substrates. The protein is found in the nucleus and cytoplasm. It functions as a co-factor of the DNA-bound androgen receptor complex, and is inhibited by a protein in the Ras-GTPase pathway. The human genome contains several pseudogenes similar to this gene. Several transcript variants, some protein-coding and others not protein-coding, have been found for this gene. [provided by RefSeq, Jan 2013]