Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TULP2 monoclonal antibody, Western Blot analysis of TULP2 expression in HeLa.)

Mouse TULP2 Monoclonal Antibody | anti-TULP2 antibody

TULP2 (Tubby-like Protein 2, TUBL2, Tubby-related Protein 2, Cancer/testis Antigen 65, CT65) (PE)

Gene Names
TULP2; CT65; TUBL2
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TULP2; Monoclonal Antibody; TULP2 (Tubby-like Protein 2; TUBL2; Tubby-related Protein 2; Cancer/testis Antigen 65; CT65) (PE); anti-TULP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B5
Specificity
Recognizes human TULP2. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-TULP2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa141-250 from human TULP2 (NP_003314) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EVSVENGSVSPPPFKQSPRIRRKGWQAHQRPGTRAEGESDSQDMGDAHKSPNMGPNPGMDGDCVYENLAFQKEEDLEKKREASESTGTNSSAAHNEELSKALKGEGGTDS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TULP2 monoclonal antibody, Western Blot analysis of TULP2 expression in HeLa.)

Western Blot (WB) (TULP2 monoclonal antibody, Western Blot analysis of TULP2 expression in HeLa.)

Western Blot (WB)

(TULP2 monoclonal antibody. Western Blot analysis of TULP2 expression in PC-12.)

Western Blot (WB) (TULP2 monoclonal antibody. Western Blot analysis of TULP2 expression in PC-12.)

Western Blot (WB)

(TULP2 monoclonal antibody. Western Blot analysis of TULP2 expression in Raw 264.7.)

Western Blot (WB) (TULP2 monoclonal antibody. Western Blot analysis of TULP2 expression in Raw 264.7.)

Western Blot (WB)

(TULP2 monoclonal antibody. Western Blot analysis of TULP2 expression in NIH/3T3.)

Western Blot (WB) (TULP2 monoclonal antibody. Western Blot analysis of TULP2 expression in NIH/3T3.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TULP2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TULP2 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-TULP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,664 Da
NCBI Official Full Name
tubby-related protein 2
NCBI Official Synonym Full Names
tubby like protein 2
NCBI Official Symbol
TULP2
NCBI Official Synonym Symbols
CT65; TUBL2
NCBI Protein Information
tubby-related protein 2; cancer testis antigen 65; cancer/testis antigen 65; tubby-like protein 2
UniProt Protein Name
Tubby-related protein 2
Protein Family
UniProt Gene Name
TULP2
UniProt Synonym Gene Names
TUBL2; CT65
UniProt Entry Name
TULP2_HUMAN

Similar Products

Product Notes

The TULP2 tulp2 (Catalog #AAA6160902) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TULP2 (Tubby-like Protein 2, TUBL2, Tubby-related Protein 2, Cancer/testis Antigen 65, CT65) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TULP2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TULP2 tulp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TULP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.