Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged TDO2 is ~10ng/ml as a capture antibody.)

Mouse anti-Human TDO Monoclonal Antibody | anti-TDO antibody

TDO (TPH2, TRPO, TDO2, Typtophan 2,3-dioxygenase, Tryptophanase, Typtophan Oxygenase, Tryptophan Pyrrolase, TO) (PE)

Gene Names
TDO2; TO; TDO; TPH2; TRPO; HYPTRP
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TDO; Monoclonal Antibody; TDO (TPH2; TRPO; TDO2; Typtophan 2; 3-dioxygenase; Tryptophanase; Typtophan Oxygenase; Tryptophan Pyrrolase; TO) (PE); anti-TDO antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C8
Specificity
Recognizes human TDO2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-TDO antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa307-405 from human TDO2 (NP_005642) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDES
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TDO2 is ~10ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TDO2 is ~10ng/ml as a capture antibody.)
Related Product Information for anti-TDO antibody
TDO incorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards tryptamine and derivatives including D- and L-tryptophan, 5-hydroxytryptophan and serotonin.
Product Categories/Family for anti-TDO antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50.0 kDa (426aa), confirmed by MALDI-TOF
NCBI Official Full Name
tryptophan 2,3-dioxygenase
NCBI Official Synonym Full Names
tryptophan 2,3-dioxygenase
NCBI Official Symbol
TDO2
NCBI Official Synonym Symbols
TO; TDO; TPH2; TRPO; HYPTRP
NCBI Protein Information
tryptophan 2,3-dioxygenase
UniProt Protein Name
Tryptophan 2,3-dioxygenase
UniProt Gene Name
TDO2
UniProt Entry Name
T23O_HUMAN

NCBI Description

This gene encodes a heme enzyme that plays a critical role in tryptophan metabolism by catalyzing the first and rate-limiting step of the kynurenine pathway. Increased activity of the encoded protein and subsequent kynurenine production may also play a role in cancer through the suppression of antitumor immune responses, and single nucleotide polymorphisms in this gene may be associated with autism. [provided by RefSeq, Feb 2012]

Uniprot Description

TDO2: Incorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards tryptamine and derivatives including D- and L-tryptophan, 5-hydroxytryptophan and serotonin. Belongs to the tryptophan 2,3-dioxygenase family.

Protein type: Amino Acid Metabolism - tryptophan; EC 1.13.11.11; Oxidoreductase

Chromosomal Location of Human Ortholog: 4q31-q32

Cellular Component: cytosol

Molecular Function: amino acid binding; metal ion binding; heme binding; oxygen binding; tryptophan 2,3-dioxygenase activity

Biological Process: tryptophan catabolic process to acetyl-CoA; tryptophan catabolic process to kynurenine; tryptophan catabolic process

Research Articles on TDO

Similar Products

Product Notes

The TDO tdo2 (Catalog #AAA6160670) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TDO (TPH2, TRPO, TDO2, Typtophan 2,3-dioxygenase, Tryptophanase, Typtophan Oxygenase, Tryptophan Pyrrolase, TO) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TDO can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TDO tdo2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TDO, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.