Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Mouse anti-Human S100A5 Monoclonal Antibody | anti-S100A5 antibody

S100A5 (Protein S100-A5, Protein S-100D, S100 Calcium-binding Protein A5, S100D) (PE)

Gene Names
S100A5; S100D
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
S100A5; Monoclonal Antibody; S100A5 (Protein S100-A5; Protein S-100D; S100 Calcium-binding Protein A5; S100D) (PE); anti-S100A5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5E1
Specificity
Recognizes human S100A5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-S100A5 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-91 from human S100A5 (NP_002953) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEY*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to S100A5 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to S100A5 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5ug/ml])

Testing Data

(Detection limit for recombinant GST tagged S100A5 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged S100A5 is 3ng/ml as a capture antibody.)
Product Categories/Family for anti-S100A5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12.9 kDa (112aa) confirmed by MALDI-TOF
NCBI Official Full Name
protein S100-A5
NCBI Official Synonym Full Names
S100 calcium binding protein A5
NCBI Official Symbol
S100A5
NCBI Official Synonym Symbols
S100D
NCBI Protein Information
protein S100-A5
UniProt Protein Name
Protein S100-A5
Protein Family
UniProt Gene Name
S100A5
UniProt Synonym Gene Names
S100D
UniProt Entry Name
S10A5_HUMAN

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions. This protein also binds Zn2+ and Cu2+, and Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the adult brain. [provided by RefSeq, Jul 2008]

Uniprot Description

S100A5: Binds calcium, zinc and copper. One subunit can simultaneously bind 2 calcium ions or 2 copper ions plus 1 zinc ion. Calcium and copper ions compete for the same binding sites. Belongs to the S-100 family.

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: cell soma; nucleus

Molecular Function: copper ion binding; protein homodimerization activity; zinc ion binding; calcium ion binding

Research Articles on S100A5

Similar Products

Product Notes

The S100A5 s100a5 (Catalog #AAA6160103) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The S100A5 (Protein S100-A5, Protein S-100D, S100 Calcium-binding Protein A5, S100D) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's S100A5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the S100A5 s100a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "S100A5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.