Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to RPL14 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Mouse anti-Human RPL14 Monoclonal Antibody | anti-RPL14 antibody

RPL14 (60S Ribosomal Protein L14, RL14, hRL14, CAG-ISL 7, CTG-B33) (PE)

Gene Names
RPL14; L14; RL14; hRL14; CTG-B33; CAG-ISL-7
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RPL14; Monoclonal Antibody; RPL14 (60S Ribosomal Protein L14; RL14; hRL14; CAG-ISL 7; CTG-B33) (PE); anti-RPL14 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B4
Specificity
Recognizes human RPL14.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
7025
Applicable Applications for anti-RPL14 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-91 from RPL14 (NP_003964) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVFRRFVEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTQVRRQAMPFKCMQLTDFILKFPHSAHQKYVRQAWQKADINTKWAATR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to RPL14 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to RPL14 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RPL14 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RPL14 is ~3ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)
Product Categories/Family for anti-RPL14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ribosomal protein L14 (RPL14), transcript variant 2, mRNA
NCBI Official Synonym Full Names
ribosomal protein L14
NCBI Official Symbol
RPL14
NCBI Official Synonym Symbols
L14; RL14; hRL14; CTG-B33; CAG-ISL-7
NCBI Protein Information
60S ribosomal protein L14
UniProt Protein Name
60S ribosomal protein L14
Protein Family
UniProt Gene Name
RPL14
UniProt Entry Name
RL14_HUMAN

NCBI Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L14E family of ribosomal proteins. It contains a basic region-leucine zipper (bZIP)-like domain. The protein is located in the cytoplasm. This gene contains a trinucleotide (GCT) repeat tract whose length is highly polymorphic; these triplet repeats result in a stretch of alanine residues in the encoded protein. Transcript variants utilizing alternative polyA signals and alternative 5'-terminal exons exist but all encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Uniprot Description

RPL14: a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L14E family of ribosomal proteins. It contains a basic region-leucine zipper (bZIP)-like domain. The protein is located in the cytoplasm. This gene contains a trinucleotide (GCT) repeat tract whose length is highly polymorphic; these triplet repeats result in a stretch of alanine residues in the encoded protein. Transcript variants utilizing alternative polyA signals and alternative 5'-terminal exons exist but all encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Protein type: Ribosomal; Translation

Chromosomal Location of Human Ortholog: 3p22-p21.2

Cellular Component: membrane; cytoplasm; cytosol

Molecular Function: protein binding; structural constituent of ribosome; RNA binding

Biological Process: SRP-dependent cotranslational protein targeting to membrane; translational elongation; cellular protein metabolic process; translation; viral reproduction; mRNA catabolic process, nonsense-mediated decay; translational initiation; viral transcription; gene expression; translational termination; ribosomal large subunit biogenesis and assembly; viral infectious cycle; rRNA processing

Similar Products

Product Notes

The RPL14 rpl14 (Catalog #AAA6160026) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RPL14 (60S Ribosomal Protein L14, RL14, hRL14, CAG-ISL 7, CTG-B33) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RPL14 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RPL14 rpl14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RPL14, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.