<
Testing Data
(Detection limit for recombinant GST tagged RNASEH1 is ~0.03ng/ml using 132617 as a capture antibody.)
Mouse anti-Human, Rat Ribonuclease H1 Monoclonal Antibody | anti-RNASEH1 antibody
Ribonuclease H1 (RNase H1, RNASEH1, RNH1, Ribonuclease H Type II, H1RNA) (PE)
Gene Names
RNASEH1; RNH1; H1RNA
Reactivity
Human, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Ribonuclease H1; Monoclonal Antibody; Ribonuclease H1 (RNase H1; RNASEH1; RNH1; Ribonuclease H Type II; H1RNA) (PE); EC=3.1.26.4; anti-RNASEH1 antibody
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5D10
Specificity
Recognizes human Ribonuclease H1. Species Crossreactivity: rat
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RNASEH1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa189-286 from human Ribonuclease H1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AACKAIEQAKTQNINKLVLYTDSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged RNASEH1 is ~0.03ng/ml using 132617 as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged RNASEH1 is ~0.03ng/ml using 132617 as a capture antibody.)
Western Blot (WB)
(Western Blot detection against Immunogen using 132617 (36.89kD).)
Western Blot (WB)
(Western Blot detection against Immunogen using 132617 (36.89kD).)
Western Blot (WB)
(Western Blot analysis of RNASEH1 expression in HeLa using 132617.)
Western Blot (WB)
(Western Blot analysis of RNASEH1 expression in HeLa using 132617.)
Western Blot (WB)
(Western Blot analysis of RNASEH1 expression in PC-12 using 132617.)
Western Blot (WB)
(Western Blot analysis of RNASEH1 expression in PC-12 using 132617.)
Western Blot (WB)
(Western Blot analysis of RNASEH1 expression in transfected 293T cell line using 132617. Lane 1: RNASEH1 transfected lysate (32.1kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of RNASEH1 expression in transfected 293T cell line using 132617. Lane 1: RNASEH1 transfected lysate (32.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RNASEH1 antibody
Ribonuclease H1 also known as RNase H1 is an enzyme that in humans is encoded by the RNASEH1 gene. The RNase H1 is a non-specific endonuclease and catalyzes the cleavage of RNA via a hydrolytic mechanism. This gene encodes an endonuclease that specifically degrades the RNA of RNA-DNA hybrids and is necessary for DNA replication and repair. This enzyme is present in both mitochondria and nuclei, which are resulted from translation of a single mRNA with two in-frame initiation start codons. The use of the first start codon produces the mitochondrial isoform and the use of the second start codon produces the nuclear isoform. The production of the mitochondrial isoform is modulated by an upstream open reading frame (uORF) which overlaps the first initiation start codon in human. An alternately spliced transcript variant has been found which encodes a shorter isoform. This gene has three pseudogenes; two of them are on different locations of chromosome 17 and one of them is on chromosome 1q32.2. [provided by RefSeq, Nov 2013].
Product Categories/Family for anti-RNASEH1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32,064 Da
NCBI Official Full Name
ribonuclease H1 isoform 1
NCBI Official Synonym Full Names
ribonuclease H1
NCBI Official Symbol
RNASEH1
NCBI Official Synonym Symbols
RNH1; H1RNA
NCBI Protein Information
ribonuclease H1; RNase H1; ribonuclease H type II
UniProt Protein Name
Ribonuclease H1
Protein Family
UniProt Gene Name
RNASEH1
UniProt Synonym Gene Names
RNH1; RNase H1
UniProt Entry Name
RNH1_HUMAN
Similar Products
Product Notes
The RNASEH1 rnaseh1 (Catalog #AAA6159959) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Ribonuclease H1 (RNase H1, RNASEH1, RNH1, Ribonuclease H Type II, H1RNA) (PE) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Ribonuclease H1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNASEH1 rnaseh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ribonuclease H1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
