Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to PRODH on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3ug/ml])

Mouse anti-Human PRODH Monoclonal Antibody | anti-PRODH antibody

PRODH (Proline Dehydrogenase 1, Mitochondrial, Proline Oxidase, Proline Oxidase 2, p53-induced Gene 6 Protein, PIG6, POX2, FLJ33744, MGC148078, MGC148079) (PE)

Gene Names
PRODH; POX; PIG6; HSPOX2; PRODH1; PRODH2; TP53I6
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRODH; Monoclonal Antibody; PRODH (Proline Dehydrogenase 1; Mitochondrial; Proline Oxidase; Proline Oxidase 2; p53-induced Gene 6 Protein; PIG6; POX2; FLJ33744; MGC148078; MGC148079) (PE); anti-PRODH antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A9
Specificity
Recognizes human PRODH.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PRODH antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa441-541, from human PRODH (NP_057419) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQ
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to PRODH on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to PRODH on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PRODH is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PRODH is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-PRODH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,231 Da
NCBI Official Full Name
proline dehydrogenase 1, mitochondrial isoform 1
NCBI Official Synonym Full Names
proline dehydrogenase (oxidase) 1
NCBI Official Symbol
PRODH
NCBI Official Synonym Symbols
POX; PIG6; HSPOX2; PRODH1; PRODH2; TP53I6
NCBI Protein Information
proline dehydrogenase 1, mitochondrial; p53-induced gene 6 protein; proline oxidase 2; proline oxidase, mitochondrial; tumor protein p53 inducible protein 6
UniProt Protein Name
Proline dehydrogenase 1, mitochondrial
UniProt Gene Name
PRODH
UniProt Synonym Gene Names
PIG6; POX2
UniProt Entry Name
PROD_HUMAN

Uniprot Description

PRODH: Converts proline to delta-1-pyrroline-5-carboxylate. Defects in PRODH are the cause of hyperprolinemia type 1 (HP-1). HP-1 is a disorder characterized by elevated serum proline levels. May be involved in the psychiatric and behavioral phenotypes associated with the 22q11 velocardiofacial and DiGeorge syndrome. Defects in PRODH are associated with susceptibility to schizophrenia type 4 (SCZD4). A complex, multifactorial psychotic disorder or group of disorders characterized by disturbances in the form and content of thought (e.g. delusions, hallucinations), in mood (e.g. inappropriate affect), in sense of self and relationship to the external world (e.g. loss of ego boundaries, withdrawal), and in behavior (e.g bizarre or apparently purposeless behavior). Although it affects emotions, it is distinguished from mood disorders in which such disturbances are primary. Similarly, there may be mild impairment of cognitive function, and it is distinguished from the dementias in which disturbed cognitive function is considered primary. Some patients manifest schizophrenic as well as bipolar disorder symptoms and are often given the diagnosis of schizoaffective disorder. Belongs to the proline oxidase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - arginine and proline; Oxidoreductase; Mitochondrial; EC 1.5.5.2

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: mitochondrial matrix; mitochondrial inner membrane

Molecular Function: proline dehydrogenase activity

Biological Process: proline catabolic process; 4-hydroxyproline catabolic process; induction of apoptosis by oxidative stress; proline catabolic process to glutamate; proline metabolic process

Disease: Hyperprolinemia, Type I; Schizophrenia 4

Similar Products

Product Notes

The PRODH prodh (Catalog #AAA6159664) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRODH (Proline Dehydrogenase 1, Mitochondrial, Proline Oxidase, Proline Oxidase 2, p53-induced Gene 6 Protein, PIG6, POX2, FLJ33744, MGC148078, MGC148079) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRODH can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRODH prodh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRODH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.