Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.76kD.)

Mouse anti-Human PQBP1 Monoclonal Antibody | anti-PQBP1 antibody

PQBP1 (Polyglutamine-binding Protein 1, PQBP-1, 38kD Nuclear Protein Containing a WW Domain, Npw38, Polyglutamine Tract-binding Protein 1, NPW38, JM26) (PE)

Gene Names
PQBP1; SHS; MRX2; MRX55; MRXS3; MRXS8; NPW38; RENS1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PQBP1; Monoclonal Antibody; PQBP1 (Polyglutamine-binding Protein 1; PQBP-1; 38kD Nuclear Protein Containing a WW Domain; Npw38; Polyglutamine Tract-binding Protein 1; NPW38; JM26) (PE); anti-PQBP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A11
Specificity
Recognizes human PQBP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1147
Applicable Applications for anti-PQBP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa184-265 from PQBP1 (NP_005701) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.76kD.)

Western Blot (WB) (Western Blot detection against Immunogen (34.76kD.)

Western Blot (WB)

(Western Blot analysis of PQBP1 expression in transfected 293T cell line by PQBP1 monoclonal antibodyLane 1: PQBP1 transfected lysate (30.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PQBP1 expression in transfected 293T cell line by PQBP1 monoclonal antibodyLane 1: PQBP1 transfected lysate (30.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PQBP1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PQBP1 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-PQBP1 antibody
May suppress the ability of POU3F2 to transactivate the DRD1 gene in a POU3F2 dependent manner. Can activate transcription directly or via association with the transcription machinery. May be involved in ATXN1 mutant-induced cell death. The interaction with ATXN1 mutant reduces levels of phosphorylated RNA polymerase II large subunit.
Product Categories/Family for anti-PQBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
polyglutamine binding protein 1
NCBI Official Symbol
PQBP1
NCBI Official Synonym Symbols
SHS; MRX2; MRX55; MRXS3; MRXS8; NPW38; RENS1
NCBI Protein Information
polyglutamine-binding protein 1
UniProt Protein Name
Polyglutamine-binding protein 1
UniProt Gene Name
PQBP1
UniProt Synonym Gene Names
NPW38; PQBP-1; Npw38
UniProt Entry Name
PQBP1_HUMAN

NCBI Description

This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.[provided by RefSeq, Nov 2009]

Uniprot Description

PQBP1: May suppress the ability of POU3F2 to transactivate the DRD1 gene in a POU3F2 dependent manner. Can activate transcription directly or via association with the transcription machinery. May be involved in ATXN1 mutant-induced cell death. The interaction with ATXN1 mutant reduces levels of phosphorylated RNA polymerase II large subunit. Defects in PQBP1 are the cause of Renpenning syndrome 1 (RENS1); also known as Sutherland-Haan X-linked mental retardation syndrome (SHS) or X-linked mental retardation syndromes MRXS3/MRXS8/MRX55. The clinical features are mental retardation, microcephaly, short stature, and small testes. The craniofacies tends to be narrow and tall with upslanting palpebral fissures, abnormal nasal configuration, cupped ears, and short philtrum. The nose may appear long or bulbous, with overhanging columella. Less consistent manifestations include ocular colobomas, cardiac malformations, cleft palate, and anal anomalies. RENS1 is more frequently in males than in females where little or no expression is found. 10 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: nucleoplasm; stress granule; cytoplasm; nuclear speck; nucleus

Molecular Function: ribonucleoprotein binding; DNA binding; transcription coactivator activity

Biological Process: alternative nuclear mRNA splicing, via spliceosome; transcription, DNA-dependent; regulation of transcription, DNA-dependent; regulation of RNA splicing; regulation of dendrite morphogenesis; neurite development

Disease: Renpenning Syndrome 1

Research Articles on PQBP1

Similar Products

Product Notes

The PQBP1 pqbp1 (Catalog #AAA6159624) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PQBP1 (Polyglutamine-binding Protein 1, PQBP-1, 38kD Nuclear Protein Containing a WW Domain, Npw38, Polyglutamine Tract-binding Protein 1, NPW38, JM26) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PQBP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PQBP1 pqbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PQBP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.