Mouse anti-Human NOS1AP Monoclonal Antibody | anti-NOS1AP antibody

NOS1AP (CAPON, KIAA0464, Carboxyl-terminal PDZ Ligand Of Neuronal Nitric Oxide Synthase Protein, C-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, Nitric Oxide Synthase 1 Adaptor Protein) (PE)

Cat. Num. AAA6159132

• Gene Names: NOS1AP; CAPON; 6330408P19Rik
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NOS1AP; Monoclonal Antibody; NOS1AP (CAPON; KIAA0464; Carboxyl-terminal PDZ Ligand Of Neuronal Nitric Oxide Synthase Protein; C-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein; Nitric Oxide Synthase 1 Adaptor Protein) (PE); anti-NOS1AP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B11
• Specificity: Recognizes human NOS1AP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 5016

• Applicable Applications for anti-NOS1AP antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa99-202 from NOS1AP (NP_055512) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: WTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQL
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NOS1AP is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-NOS1AP antibody

This gene encodes a cytosolic protein that binds to the signaling molecule, neuronal nitric oxide synthase (nNOS). This protein has a C-terminal PDZ-binding domain that mediates interactions with nNOS and an N-terminal phosphotyrosine binding (PTB) domain that binds to the small monomeric G protein, Dexras1. Studies of the related mouse and rat proteins have shown that this protein functions as an adapter protein linking nNOS to specific targets, such as Dexras1 and the synapsins. Alternative splicing results in multiple transcript variants encoding different isoforms.

Product Categories/Family for anti-NOS1AP antibody

Antibodies; Nitric Oxide

NCBI and Uniprot Product Information

• NCBI GI #: 1519314295
• NCBI GeneID: 9722
• NCBI Accession #: NM_014697.3
• NCBI GenBank Nucleotide #: NM_014697
• UniProt Accession #: O75052
• NCBI Official Full Name: Homo sapiens nitric oxide synthase 1 adaptor protein (NOS1AP), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: nitric oxide synthase 1 adaptor protein
• NCBI Official Symbol: NOS1AP
• NCBI Official Synonym Symbols: CAPON; 6330408P19Rik
• NCBI Protein Information: carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
• UniProt Protein Name: Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
• Protein Family: Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
• UniProt Gene Name: NOS1AP
• UniProt Synonym Gene Names: CAPON; KIAA0464
• UniProt Entry Name: CAPON_HUMAN

NCBI Description

This gene encodes a cytosolic protein that binds to the signaling molecule, neuronal nitric oxide synthase (nNOS). This protein has a C-terminal PDZ-binding domain that mediates interactions with nNOS and an N-terminal phosphotyrosine binding (PTB) domain that binds to the small monomeric G protein, Dexras1. Studies of the related mouse and rat proteins have shown that this protein functions as an adapter protein linking nNOS to specific targets, such as Dexras1 and the synapsins. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2009]

Uniprot Description

NOS1AP: Adapter protein involved in neuronal nitric-oxide (NO) synthesis regulation via its association with nNOS/NOS1. The complex formed with NOS1 and synapsins is necessary for specific NO and synapsin functions at a presynaptic level. Mediates an indirect interaction between NOS1 and RASD1 leading to enhance the ability of NOS1 to activate RASD1. Competes with DLG4 for interaction with NOS1, possibly affecting NOS1 activity by regulating the interaction between NOS1 and DLG4. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: nuclear membrane; sarcoplasmic reticulum membrane; mitochondrion; perinuclear region of cytoplasm; T-tubule; caveola; Z disc; cytosol; nucleus; sarcolemma

Molecular Function: nitric-oxide synthase binding

Biological Process: regulation of apoptosis; regulation of nitric oxide biosynthetic process; positive regulation of nitric oxide biosynthetic process; chemical signal regulation of heart rate; positive regulation of nitric-oxide synthase activity; regulation of nitric-oxide synthase activity

Disease: Qt Interval, Variation In