Mouse anti-Human NCAPD2 Monoclonal Antibody | anti-NCAPD2 antibody

NCAPD2 (CAPD2, CNAP1, KIAA0159, Condensin Complex Subunit 1, Chromosome Condensation-related SMC-associated Protein 1, Chromosome-associated Protein D2, hCAP-D2, Non-SMC Condensin I Complex Subunit D2, XCAP-D2 Homolog) (PE)

Cat. Num. AAA6159008

• Gene Names: NCAPD2; CNAP1; CAP-D2; hCAP-D2
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NCAPD2; Monoclonal Antibody; NCAPD2 (CAPD2; CNAP1; KIAA0159; Condensin Complex Subunit 1; Chromosome Condensation-related SMC-associated Protein 1; Chromosome-associated Protein D2; hCAP-D2; Non-SMC Condensin I Complex Subunit D2; XCAP-D2 Homolog) (PE); anti-NCAPD2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4C12
• Specificity: Recognizes human CNAP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-NCAPD2 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1240-1339 from CNAP1 (AAH28182) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD.)

Western Blot (WB)

(CNAP1 monoclonal antibody Western Blot analysis of CNAP1 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CNAP1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CNAP1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CNAP1 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-NCAPD2 antibody

Antibodies; Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 20380095
• NCBI GeneID: 9918
• Molecular Weight: 157,182 Da
• NCBI Official Full Name: Homo sapiens non-SMC condensin I complex, subunit D2, mRNA
• NCBI Official Synonym Full Names: non-SMC condensin I complex subunit D2
• NCBI Official Symbol: NCAPD2
• NCBI Official Synonym Symbols: CNAP1; CAP-D2; hCAP-D2
• NCBI Protein Information: condensin complex subunit 1
• Protein Family: Condensin complex