Mouse anti-Human MYH3 Monoclonal Antibody | anti-MYH3 antibody

MYH3 (Myosin-3, Muscle Embryonic Myosin Heavy Chain, Myosin Heavy Chain 3, Myosin Heavy Chain, Fast Skeletal Muscle, Embryonic, SMHCE) (PE)

Cat. Num. AAA6158959

• Gene Names: MYH3; HEMHC; SMHCE; MYHSE1; MYHC-EMB
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MYH3; Monoclonal Antibody; MYH3 (Myosin-3; Muscle Embryonic Myosin Heavy Chain; Myosin Heavy Chain 3; Myosin Heavy Chain; Fast Skeletal Muscle; Embryonic; SMHCE) (PE); anti-MYH3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3H3
• Specificity: Recognizes human MYH3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-MYH3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa2-100 from human MYH3 (NP_002461.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged MYH3 is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-MYH3 antibody

Antibodies; Motor Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 98986453
• NCBI GeneID: 4621
• NCBI Accession #: NP_002461.1
• NCBI GenBank Nucleotide #: NM_002470
• UniProt Accession #: P11055; Q15492
• Molecular Weight: 223,905 Da
• NCBI Official Full Name: myosin-3
• NCBI Official Synonym Full Names: myosin, heavy chain 3, skeletal muscle, embryonic
• NCBI Official Symbol: MYH3
• NCBI Official Synonym Symbols: HEMHC; SMHCE; MYHSE1; MYHC-EMB
• NCBI Protein Information: myosin-3; myosin, skeletal, heavy chain, embryonic 1; myosin heavy chain, fast skeletal muscle, embryonic; myosin, heavy polypeptide 3, skeletal muscle, embryonic
• UniProt Protein Name: Myosin-3
• UniProt Gene Name: MYH3
• UniProt Entry Name: MYH3_HUMAN

NCBI Description

Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. This gene is a member of the MYH family and encodes a protein with an IQ domain and a myosin head-like domain. Mutations in this gene have been associated with two congenital contracture (arthrogryposis) syndromes, Freeman-Sheldon syndrome and Sheldon-Hall syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

MYH3: Muscle contraction. Defects in MYH3 are the cause of distal arthrogryposis type 2A (DA2A); also known as Freeman-Sheldon syndrome (FSS). Distal arthrogryposis is a clinically and genetically heterogeneous group of disorders characterized by bone anomalies and joint contractures of the hands and feet, causing medially overlapping fingers, clenched fists, ulnar deviation of fingers, camptodactyly and positional foot deformities. It is a disorder of primary limb malformation without primary neurologic or muscle disease. DA2A is the most severe form of distal arthrogryposis. Affected individuals have contractures of the orofacial muscles, characterized by microstomia with pouting lips, H-shaped dimpling of the chin, deep nasolabial folds, and blepharophimosis. Dysphagia, failure to thrive, growth deficit, and life-threatening respiratory complications (caused by structural anomalies of the oropharynx and upper airways) are frequent. Inheritance is autosomal dominant. Defects in MYH3 are the cause of distal arthrogryposis type 2B (DA2B); also known as Sheldon-Hall syndrome (SHS) or arthrogryposis multiplex congenita distal type 2B (AMCD2B). DA2B is a form of inherited multiple congenital contractures. Affected individuals have vertical talus, ulnar deviation in the hands, severe camptodactyly, and a distinctive face characterized by a triangular shape, prominent nasolabial folds, small mouth and a prominent chin. DA2B is the most common of the distal arthrogryposis syndromes. It is similar to DA2A but the facial contractures are less dramatic.

Protein type: Motor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: sarcomere; muscle myosin complex; cytosol

Molecular Function: microfilament motor activity; calmodulin binding; actin filament binding; ATPase activity, coupled; ATP binding

Biological Process: skeletal muscle contraction; muscle development; actin filament-based movement; metabolic process; sarcomere organization; muscle filament sliding; embryonic limb morphogenesis

Disease: Arthrogryposis, Distal, Type 8; Arthrogryposis, Distal, Type 2a; Arthrogryposis, Distal, Type 2b